KEGG   Bacillus oceanisediminis: A361_05370Help
Entry
A361_05370        CDS       T04330                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00430  Taurine and hypotaurine metabolism
bon00460  Cyanoamino acid metabolism
bon00480  Glutathione metabolism
bon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    A361_05370
   00460 Cyanoamino acid metabolism
    A361_05370
   00480 Glutathione metabolism
    A361_05370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bon01002]
    A361_05370
Enzymes [BR:bon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     A361_05370
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     A361_05370
Peptidases and inhibitors [BR:bon01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   A361_05370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AND38574
UniProt: A0A160M8B7
Position
1042822..1044603
Genome map
AA seq 593 aa AA seqDB search
MRRVLKASVLMLLSILLVAGTMPLTGQAKKPKPDDGYGGYSQVDVGKDGMVASAHPLASK
IGADVLKNGGNAIDAAVAVQFALNVVEPMMSGIGGGGFMMVYDGKTKETSIINSRERAPA
GAAPDMFLDENGKPIPFAERSTGGTAVGVPGTLKGLETALEKWGTRPMQQLIGPAIKLAD
KGFPIDSVLADAIADNQDKLGRTAAGKVFLPKGEPIEEGERLVQKDLAKTLKMIRAGGTD
AFYNGKIAEALAGVVQDFGGSMTPEDLAGYEVTIDEPIWGDYQGYEIASMPPPSSGGVFL
LQMLKILDDFNLSQYDLKSWEKYHLLAETMHLAYADRVVYAGDPEFVNVPVNGLLHPDYI
KERQELISLNEVNPSPEAGDPWKYENSEANYEAAEQPNDRQYGETTHFSVTDRWGNVVSY
TTTIEQVFGTGIMVPGYGLMLNNELTDFDAVPGGANEVQPNKRPLSSMTPTIVFEDGEPV
LTVGSPGGPTIITSVLQTILYAIEYDMELKAAVEEPRIYTNNLNSYRYEEGIPSEVINRL
KGMGHSFGPSPTTIGNVQSILIDRDKGIFKGVADSSRNGAAIGVDLKGKGKSK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagaagagttttgaaagctagtgtcctaatgcttttaagtattttactagttgccgga
accatgcctttaaccgggcaggcgaaaaagccgaagcctgatgatggctatggcggctat
agccaggttgatgttggcaaggacggaatggtggcttcagcccatccgctggcatcaaaa
attggggcagatgtcttgaaaaatggcggtaatgccatcgatgcggctgtcgcagtccaa
ttcgcccttaatgttgtggaaccaatgatgtccggaattggcgggggtggtttcatgatg
gtctatgatggcaaaacgaaagaaaccagcattattaacagccgtgagcgcgctccagca
ggtgccgcaccagatatgttcctggatgaaaacggaaagccgattccatttgcggagcgt
tcaactggcggtacggcagtcggtgtgcccggcacattgaaaggattggaaacggccctt
gaaaaatggggaacacgccctatgcagcagctgatcggccctgccattaagctggcagat
aaaggattcccaatagattctgtattagccgatgcgattgccgataatcaggacaagctt
ggcagaacagctgccggcaaagtgtttttgcctaagggcgaacctattgaagaaggggag
cgtctagtacagaaggatcttgcaaaaaccctgaagatgatacgtgctggcgggacagac
gctttttataatgggaaaatcgcagaagctcttgctggtgtggtgcaggattttggcgga
tccatgacacctgaagaccttgcgggatatgaagtgactattgatgagcctatttgggga
gattaccaggggtatgaaattgcgagcatgccgcccccaagctctggcggagtgtttttg
ctgcagatgctgaagattctggatgattttaatctatcacaatatgatttaaaatcctgg
gagaaatatcacctgcttgctgagaccatgcatcttgcctatgcagaccgcgtcgtatat
gcaggagatccagagtttgtaaatgtcccagtcaatgggctgcttcaccctgattatatt
aaggagcgccaggaactgatcagcctgaatgaagtgaatccaagcccggaagcgggagat
ccttggaaatatgagaacagtgaagccaattatgaagcagctgaacagccgaatgaccgc
caatacggtgagaccactcatttttctgtaacggacagatggggaaatgttgtctcatat
accacaacgattgaacaggtattcggaacaggaatcatggttccaggctacgggctgatg
ctgaataatgagctgacagattttgatgctgtaccgggcggggcaaatgaagtccagcca
aacaagcggcctttaagctcgatgaccccgacgattgtctttgaagatggagagccggtc
ctgactgtcggttcaccaggcggcccaacgattataacatcagtactgcagacgatcctt
tacgccattgaatatgacatggagctaaaagcagcagttgaagaaccgcgaatctataca
aataatctgaattcctaccgctatgaagagggaattccttcagaagttattaataggcta
aaagggatggggcatagcttcggtccgagtccgaccacgattggaaacgtccaaagtatt
ttgatcgaccgggacaaaggaattttcaaaggtgtggcagattcaagccgcaatggtgct
gccattggtgttgatttgaaaggaaaagggaaaagcaaataa

DBGET integrated database retrieval system