KEGG   Bacillus oceanisediminis: A361_13085Help
Entry
A361_13085        CDS       T04330                                 

Definition
(GenBank) bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00270  Cysteine and methionine metabolism
bon00670  One carbon pool by folate
bon01100  Metabolic pathways
bon01110  Biosynthesis of secondary metabolites
bon01120  Microbial metabolism in diverse environments
bon01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A361_13085
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    A361_13085
Enzymes [BR:bon01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     A361_13085
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     A361_13085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR
Motif
Other DBs
NCBI-ProteinID: AND40037
UniProt: A0A160MB26
Position
2576844..2578694
Genome map
AA seq 616 aa AA seqDB search
MSFLNKLKNEIIIADGAMGTLLYSYGTDSCFEELNLSQSEQIQHIHEAYIGAGAELIQTN
TYAANYLKLQRYGLEDSVKEINSAAARIAKKAAKERAYVAGTIGGIRGFKPNMITLEEIK
RSFREQLYCLLLENVDGILLETYYDLEELETVLAIARKETDLPIIAQVSLQEAGVLQNQT
SIADALAKLEGIGADVLGINCRLGPHHMLKTLESVPLPKHAYLSAYPNASIPAYTDGKFH
YEGDAEYFRQSAIEFRNQGVRLLGGCCGTTPDHIKAFSDVLKGLPPIEEKETKAINKVMV
SEKPSSSRELPPLQDIVRERPSVIVELDPPRKLDTSRFFEGAKALKEAGIDSITLADNSL
ASPRVCNSALGYLVKQQTGLRPLVHVTCRDRNIIGLQSHLMGLHALGLNDILAVTGDPAR
VGDFPGASSVYDVSSFELISMIKQLNEGLSFSGKDLGQKAAFSVAGAFNPNVRSLEKAVG
RLEKKIEHGADYFISQPVFSEEKLLEVHEAVKDLKAPVYIGLMPLTGSRNAEFLHNEVPG
IKISDSIRNRMASLKDDPAQAGAEGIAIAKSLIDAAAELFNGIYLITPFMRYEMTVELSN
YARETTERLSRRKQHA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
ttgagtttcctaaataaattaaagaatgaaatcatcatagcagatggcgcgatgggaact
cttctgtactcctatggtaccgacagctgttttgaggaattaaatttatcacaatctgaa
cagatccagcacatccatgaagcatacataggcgcaggggctgaattgatccaaacaaat
acgtatgcggcgaattatttgaagcttcagcgatatggactggaagactccgttaaggag
attaacagtgctgcagcaaggattgccaaaaaagctgccaaggaacgcgcatatgttgct
ggtacaatcggcgggatcaggggattcaagcccaacatgattacacttgaagaaataaaa
agaagcttcagggagcagctttattgcctgctgcttgagaatgtagatggtattttgctt
gaaacctattatgacctggaagagcttgagactgtccttgccatagccaggaaagaaact
gatttgccgattatcgcacaggtgtctcttcaggaagcgggtgttcttcagaaccagact
tctatcgctgatgctttagcaaagcttgaaggaattggtgcggatgttttgggaatcaat
tgcaggcttggtccgcatcatatgctgaaaactctcgaaagtgtgcctttgccaaagcat
gcctatctttctgcttatccaaatgccagtattccagcctatacggatggcaaatttcat
tatgaaggagatgcagaatatttccggcagtcagcgattgaattccgaaatcagggtgtc
cgcctgcttggaggctgctgtggaacaacacctgaccatatcaaggcgttttctgacgtt
ttaaaaggacttccgccaatagaggaaaaagagacaaaggcaatcaataaagtcatggtt
tctgaaaagccatcatcatcaagagagctccctcctcttcaagatattgtcagggaaagg
ccttctgtcattgttgaattggatcctccaaggaagcttgatacttcacgctttttcgaa
ggtgcaaaagcattgaaagaagccggaatagattctattacacttgcagataactccctt
gcttccccccgggtatgcaactctgcgcttggatatctcgtcaagcagcagacaggattg
cgcccgcttgttcatgtgacctgcagggataggaatattattggactgcaatcccattta
atgggtctgcacgcacttggattaaatgatattcttgccgtaacgggtgatcctgcacgt
gtcggtgattttccaggagcatcttctgtatatgatgtctcatcatttgaattgatcagt
atgatcaagcagttaaatgaagggttatctttttcagggaaagatctcggccagaaagct
gccttttcagttgcaggggcttttaatcccaatgtccgctcattggaaaaagctgttgga
cggcttgaaaagaaaattgaacatggtgcggactatttcatctcgcagcctgttttttct
gaagagaagctgctggaagttcatgaggctgtgaaagatttaaaagcacctgtttatata
ggcctaatgcctcttaccggcagccggaatgctgagtttctgcataatgaagttcctgga
atcaaaatttccgacagcattagaaaccggatggcttcattaaaggatgatcctgcacag
gctggagctgaaggcatagctattgccaagtcgctgatcgatgccgcggcagagctgttt
aatggcatttacctcatcactccatttatgcgctatgaaatgactgttgaactatcaaac
tatgcccgtgagacaaccgaacggctttcaaggaggaaacaacatgcataa

DBGET integrated database retrieval system