KEGG   Bacillus oceanisediminis: A361_13160Help
Entry
A361_13160        CDS       T04330                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00260  Glycine, serine and threonine metabolism
bon01100  Metabolic pathways
bon01110  Biosynthesis of secondary metabolites
bon01120  Microbial metabolism in diverse environments
bon01130  Biosynthesis of antibiotics
bon01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A361_13160
Enzymes [BR:bon01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     A361_13160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_3 Aminotran_5 Cys_Met_Meta_PP OKR_DC_1 DegV
Motif
Other DBs
NCBI-ProteinID: AND40052
UniProt: A0A160MB67
Position
complement(2592770..2593801)
Genome map
AA seq 343 aa AA seqDB search
MTDLRSDTVTKPTEEMRKAAYEAEVGDDVYGEDPSINKLEETAAEVLGKEAALFVTSGTQ
GNQIAILTHCRPGNEIILEAESHIFYYESGASSAFAGVQTRTLNGIRGAMNPSEVEYAIR
GEDQHYPETGLICLENTHNRAGGAVIPIDNMEEIYRIAKTNNIPVHIDGARLFNAAAALN
LPASEMANHCDTVQVCLSKGLGAPVGSILAGSREFIAAARKWRKRLGGGLRQAGIIAAPG
IVALTNMRERLAEDHENAQYLAQQLGQIKGIEIVNQVDTNIIVADVKNLKMNSSEFVEKL
KAEGVLSGTFGPSYVRFVTHYDVTKKQLEDAVIAIHRTAGQMI
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttaagaagtgatacggttacaaagccaactgaagaaatgaggaaagctgct
tatgaagctgaagttggggatgacgtatacggagaggatccatcaataaataaattggaa
gagacagctgctgaggtgcttggtaaggaggcagctctgtttgtaacgagcggcacacag
ggaaaccagattgccatcttaacacattgccgtccgggcaatgaaattattcttgaagca
gaaagccatattttttattatgaaagcggcgcttcatctgcctttgccggagtccagaca
aggacgctaaatgggataagaggtgcaatgaatccttcagaagtggagtatgccattagg
ggagaagatcagcattatccggaaacaggattgatttgtctggaaaatacccataacaga
gctggcggtgccgtaatacctattgataatatggaagaaatatacagaattgccaaaacg
aataatattcccgtacatattgatggggcaagactgtttaatgcagccgcagccttaaac
ctgccggcttctgaaatggccaatcattgcgacactgtgcaagtatgcctctctaagggg
ctcggagcacctgttggttccattcttgcaggcagcagagaatttattgctgcagcaaga
aaatggcgcaaaagattgggagggggactccgccaggctgggatcatagcagccccggga
attgttgcattaacgaatatgagagagcgtttagccgaggatcacgaaaatgctcaatat
cttgcacagcagcttggacaaatcaaagggattgaaatcgtaaatcaagtagatacaaat
atcattgtggctgatgtaaaaaaccttaaaatgaactcatcggaatttgttgaaaagtta
aaagctgagggagtgctttcaggaactttcggaccttcttatgtgcgttttgtcactcac
tatgatgttactaaaaagcagcttgaagatgcagtcatagccatacacagaacagctggt
caaatgatctaa

DBGET integrated database retrieval system