KEGG   Bacillus oceanisediminis: A361_13910Help
Entry
A361_13910        CDS       T04330                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00061  Fatty acid biosynthesis
bon00071  Fatty acid degradation
bon01100  Metabolic pathways
bon01212  Fatty acid metabolism
bon02024  Quorum sensing
Module
bon_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A361_13910
   00071 Fatty acid degradation
    A361_13910
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A361_13910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bon01004]
    A361_13910
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bon04147]
    A361_13910
Enzymes [BR:bon01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     A361_13910
Lipid biosynthesis proteins [BR:bon01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   A361_13910
Exosome [BR:bon04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   A361_13910
  Exosomal proteins of breast cancer cells
   A361_13910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AND40198
UniProt: A0A160MCQ5
Position
complement(2740342..2741955)
Genome map
AA seq 537 aa AA seqDB search
MSEKKTWHAHYPESIAADVSIPSKSMPEMLQEVTAMYPQNTALSFYGRKMIYAELQKAVY
GFAASLQKNGVQKGGRVAIMLPNCPQYVIAYYGTLAAGAIVTQVNPMLVEREIEYIMNDS
GAETLIVFDALYPRVKGVQSKTKLSNIIVVSLQQSNADFSPDKTFDGFLHEGKGQFTPVN
IEPEQEIAVLQYTGGTTGRSKGAMLTHYNVLANVVQSYEFFKERTKIGGEKFLTVIPLFH
VFGMTACMNFAIYTANESILLPRFDLEEVLNTIKNEQPSVFPGVPTMYVAITNHPRAEEY
GIDSIETCNSGSAPMPVELLRDFEQKTGAKILEGYGLSEASPVTHCNPPFSERKPGSVGI
GFPSTDYKVVDLATGTEEVPNGELGEVIIKGPQIMRGYWNMPEETAVTLRDGWLYTGDIA
RMDDDGFLYIVDRKKDLIIASGYNIYPRDIEEVLYEHPAVQEAVVIGVPDAYRGETVKAF
IVLKAGKSSSEKDIISYCKQNLAAYKIPSAVEFRQELPKTNVGKILRRALRDEVRSH
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagaaaacctggcatgcccactatcctgaatcaattgcagccgatgttagc
attcccagcaagtcgatgcctgagatgctgcaggaagtgacagcgatgtatccgcagaat
acagctttatctttttatggccgaaaaatgatttatgcggaacttcaaaaagccgtctat
ggatttgctgcatcactgcagaaaaatggtgtccaaaaaggcggccgtgttgccatcatg
ctgcccaattgcccgcaatatgtaattgcgtattatggcacccttgcagcgggagcgatc
gttactcaagtaaacccgatgctggttgagcgcgagatagagtatattatgaatgattcg
ggtgctgagacacttatcgtctttgatgcgttatatccacgcgtaaaaggagtacagagc
aaaacgaaattaagtaatataattgttgtcagtctccagcaatcaaatgcagatttttct
cctgataaaacctttgatggttttttacatgaaggcaaaggacaattcaccccggtaaac
attgagcctgaacaggaaatagccgtccttcaatatacgggcggtacaaccggccgatct
aaaggagccatgctgacacattacaatgttctcgcaaatgtggttcagtcctatgaattt
tttaaagaaagaaccaaaataggcggggaaaaattcttaaccgtcattccgctgttccac
gtttttggaatgactgcctgcatgaactttgccatttataccgccaatgaatctatttta
ttgcctcgctttgatttggaggaagtgcttaatacgattaaaaatgagcagccttctgta
tttccgggtgttccaaccatgtatgtggctatcaccaatcatccgcgtgcagaggaatat
ggcattgacagcattgaaacctgcaatagcggaagcgcgccaatgcctgtcgaactgctt
cgcgattttgaacaaaagacaggagccaaaatactcgaaggctatggtttatccgaagct
tccccagtaacccactgcaatcctcctttttcagaacgaaagcctggaagtgtcggaatt
ggttttccttcaactgattataaagtagtcgatttggccacaggaacagaagaagttccg
aatggagaactcggagaggtcatcatcaagggaccgcagatcatgagaggatattggaat
atgcctgaggagacggccgtcacattacgggatggatggctctacacaggtgatattgca
agaatggatgatgacggtttcctttatattgtcgaccgtaaaaaagacctgattattgca
agcggatataatatatatcctcgcgatatcgaagaagtgctctatgagcatcctgcagtt
caggaggcagtagtcattggtgtcccggatgcgtaccggggtgaaacagtaaaagctttc
atcgtactgaaagctggcaaatcgtcaagcgaaaaagatatcatttcatattgcaagcag
aacctggctgcctataaaattccatcggccgtagaattccgccaggagcttccaaagaca
aatgtcggaaaaatccttcgccgggctttgcgggatgaggtccggagccactga

DBGET integrated database retrieval system