KEGG   Bacillus oceanisediminis: A361_14740Help
Entry
A361_14740        CDS       T04330                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00051  Fructose and mannose metabolism
bon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A361_14740
Enzymes [BR:bon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     A361_14740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N 3HCDH_N UPF0052 ApbA NAD_Gly3P_dh_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AND40355
UniProt: A0A161IY91
Position
complement(2911567..2912700)
Genome map
AA seq 377 aa AA seqDB search
MKQAVHFGAGNIGRGFIGALFSQSGYHVTFVDIADEIINQLNEEKHYQVLLASDEQESMT
IENVSGLNNLKQEKEVIEAIKQADFLTTAIGPNILPRIAPLIAKGLAARAAAGINEKLYV
IACENQISATDLLKGYIMEHLDRDVNLAGVSFLNSAVDRIVPIQNNQGSLDVLVEPYHEW
VVEVTEDIPHIEGMKIVQELAPFIERKLFTVNTGHAVIAYFGYLGGKETIDQTLADEEIY
KQVQATLRETGAYLINRYNLNPEDHQKYIDKIIGRFQNAHLNDGVTRVGRSPIRKLGPED
RLVRPALQAQKAGLSYTNLAKAIAAALMFDNREDEEAVKLQEMIQENGVPNVLKEVCGLE
ESSELAIEVLKQYEALK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcagtgcattttggagcagggaacataggaagaggttttatcggagcccta
ttttcacagtcaggctaccatgtaacttttgttgatattgccgacgaaatcattaatcag
ctgaacgaagaaaagcattatcaagtgctgctggcttcagatgaacaggaatccatgaca
attgaaaatgtttcaggattgaataatctgaaacaggagaaagaagtgatagaggccatt
aagcaggctgacttcttaacaacagcgattggccctaatatccttccgcggattgcccca
ttaattgcaaaaggcctggctgcaagagcagctgcaggaattaacgaaaagctttatgtc
attgcatgtgaaaaccagatctctgcgactgacctattaaaaggctacattatggagcat
cttgacagagatgtaaatctggcgggtgtatctttcttaaactccgccgtagaccgaatt
gtcccaatccagaacaatcagggatcactggatgttcttgttgaaccgtaccatgaatgg
gtggtggaggtgactgaagatattccgcatatcgaaggaatgaaaattgttcaggagctt
gcgccatttatcgaaagaaagctgttcacggttaacacaggacatgccgttattgcttat
ttcggatacctgggcggaaaagaaaccatcgaccagacacttgcagatgaagaaatttat
aagcaggttcaggcaacactccgagaaacaggtgcctatttgattaatcgatataatctg
aatccggaggaccatcagaagtatattgataaaattatcggccggttccaaaatgcccac
ctgaatgacggtgtcacacgagtaggacgctcgccgataaggaagcttggccctgaagac
agactggttcgtccggccctgcaggcacaaaaagcaggcttatcttacacaaacctggct
aaagcaattgctgcggcactaatgtttgataacagggaagacgaggaagcagtaaagcta
caggagatgattcaagaaaacggagtgccaaacgtgctgaaagaagtatgcggacttgaa
gaatcaagcgagcttgctatagaagtactgaaacagtatgaagcattgaaataa

DBGET integrated database retrieval system