KEGG   Bacillus oceanisediminis: A361_16215Help
Entry
A361_16215        CDS       T04330                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A361_16215
Enzymes [BR:bon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A361_16215
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A361_16215
    1.1.1.-  
     A361_16215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox 2-Hacid_dh_C Pyr_redox_2 F420_oxidored ADH_zinc_N_2 Methyltransf_24 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AND40631
UniProt: A0A169FRX5
Position
complement(3224850..3225908)
Genome map
AA seq 352 aa AA seqDB search
MKAALWYNTKDIRLETIPEPSLEKDQVKIKVSYCGICGSDLHEYLAGPIFIPVEEPHPIS
KDKAPIVMGHEFAGVVAAVGEDVTGIEVGDRVCVEPIYSCGTCRSCRKGHYNVCEHLGFI
GLSGGLGGFSEYSVVPSKMIHKIPDHMTWEQAALVEPAAVAVHAVRQSDMKIGDSVAVIG
TGPIGLLVIQAAKAAGASKIVAVEVSPERRDFAKQAGADLVMDPLESDPIQAIKEFTDGL
GVDVAFEAAGIEAAIHTAIESTKPEGNVVNISIWEKPASIPVNQFILTERKMTSIIAYRN
IFPQVIQLLANGQMKATEFITKKISLDQIVTEGFEALTKNKNQIKILVDPSL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagctgctctttggtataacacaaaagatatccgtttggaaacaattcctgagcct
tctcttgaaaaggatcaggtgaaaataaaggtttcttattgtggcatatgcgggtcagat
ttgcacgaatatttggccggtcccatttttatcccagtagaagaaccccaccccatatcg
aaggacaaggcgccgattgtcatgggtcatgagtttgccggggtggtcgctgccgttggg
gaagatgtaactggaatagaagtgggggaccgcgtgtgcgtagaaccgatttacagctgc
ggaacatgccgctcttgccggaaaggacactataatgtttgtgaacatttaggttttatc
ggtctttccggcggattaggcggcttttcagaatacagtgtggtgccatctaagatgatt
cataaaattccggaccatatgacatgggaacaggcagctctagttgagccggcagctgtt
gccgttcacgctgtccgccaaagtgacatgaagattggggattcagtcgcagttattgga
acagggccaatcggtttattggttattcaagcagctaaggcagcgggtgcaagtaaaatc
gttgcagtcgaggtttccccggaacgaagggattttgcaaaacaggctggagcagacctt
gtcatggatcctttagaaagtgaccccattcaagccataaaagaatttactgatgggctt
ggagttgatgttgcatttgaggcagctggcatcgaggctgctattcataccgcaattgaa
tcgacaaaaccggaagggaatgtagtgaatatcagtatatgggaaaaacctgccagcatt
ccggtaaaccaatttattttaacagagagaaagatgactagtatcatagcttatcgaaac
atcttcccgcaagttattcaattgcttgcgaatgggcaaatgaaagcaacagagttcatc
acgaaaaaaatttcccttgatcaaatcgttactgaagggtttgaagcactcacgaaaaat
aaaaaccaaattaaaatattggtagatccatcattataa

DBGET integrated database retrieval system