KEGG   Bacillus oceanisediminis: A361_19915Help
Entry
A361_19915        CDS       T04330                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00071  Fatty acid degradation
bon00072  Synthesis and degradation of ketone bodies
bon00280  Valine, leucine and isoleucine degradation
bon00310  Lysine degradation
bon00362  Benzoate degradation
bon00380  Tryptophan metabolism
bon00620  Pyruvate metabolism
bon00630  Glyoxylate and dicarboxylate metabolism
bon00640  Propanoate metabolism
bon00650  Butanoate metabolism
bon00900  Terpenoid backbone biosynthesis
bon01100  Metabolic pathways
bon01110  Biosynthesis of secondary metabolites
bon01120  Microbial metabolism in diverse environments
bon01130  Biosynthesis of antibiotics
bon01200  Carbon metabolism
bon01212  Fatty acid metabolism
bon02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A361_19915
   00630 Glyoxylate and dicarboxylate metabolism
    A361_19915
   00640 Propanoate metabolism
    A361_19915
   00650 Butanoate metabolism
    A361_19915
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A361_19915
   00072 Synthesis and degradation of ketone bodies
    A361_19915
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A361_19915
   00310 Lysine degradation
    A361_19915
   00380 Tryptophan metabolism
    A361_19915
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A361_19915
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A361_19915
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A361_19915
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bon04147]
    A361_19915
Enzymes [BR:bon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A361_19915
Exosome [BR:bon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A361_19915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III CMD
Motif
Other DBs
NCBI-ProteinID: AND41326
UniProt: A0A160ME18
Position
complement(3952030..3953217)
Genome map
AA seq 395 aa AA seqDB search
MAQTEVVIVSAVRTAIGSFNGSLKDVSAPELGAIAIKGALEKAGVTPDQIDEVILGNVLQ
AGLGQNPARQAALKAGLHESVSAMTINKVCGSGLKAVHLAAQAILAGDAEAVIAGGMENM
SQAPYILKNARNGFKMGDQKLIDSMISDGLWCAFNDYHMGVTAENLCSKYELSREEQDEF
AAASQEKAAKAIEEGKFNDEIVPVEIPQRKGDPIVFNTDEYPKKGTNAEKLAGLRPAFKK
DGSVTAGNASGINDGAAVLLVMSKKKADALGLKPLVTIKGNASAGVDPSIMGIGPVAAVK
KALEKASVSMDELELIEANEAFAAQSLAVDRELRFNKEILNVNGGAIALGHPIGASGARI
LVTLIHEMQKRQAKKGLATLCIGGGQGVATVVELA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaacagaagtcgtaatagtcagcgctgtccggacagcaatcggcagttttaat
ggaagccttaaagacgtatcagcaccagagcttggggcgattgcgataaaaggcgcactt
gaaaaagcaggtgtaacaccggatcagatagatgaagtaatcctggggaatgtcctgcag
gcaggtctgggacagaatccggcaaggcaggcagctcttaaagcgggccttcatgaaagc
gtttccgcaatgacgattaataaggtctgcggttccgggctgaaagcagttcatttagct
gcacaggccattttagccggtgatgcagaagcggtgattgctggcggcatggagaatatg
agtcaggctccttacatactgaaaaatgcaagaaatggctttaaaatgggagatcaaaag
cttatagattcgatgatatcagacgggctctggtgtgcatttaatgattaccatatggga
gttactgctgagaatctctgctctaaatacgagctgagccgggaagaacaggacgaattc
gcagcagccagccaggaaaaggcggcaaaggcaattgaagaaggaaaattcaatgatgaa
atcgttcctgtggaaattcctcagcgaaaaggggatccgattgtttttaatacagacgag
tatccaaaaaaagggacgaatgctgaaaagctcgcaggcctgcgcccggcgtttaagaaa
gacggcagcgtaacagccggtaatgcttccgggattaatgacggtgctgcggtattgctt
gttatgagcaaaaagaaagcagatgcacttggacttaagccattagtaacgattaaagga
aatgcaagtgcaggtgtggatccaagcatcatgggcattggccctgttgctgcggtaaaa
aaagctcttgaaaaggcttctgtttccatggatgaattggagcttattgaagcaaacgaa
gcatttgcagcccagtcgctcgcagttgacagggagcttcgttttaacaaggagattctg
aatgtaaatggcggggcaattgcgctcggacatccaatcggcgcaagcggtgcaagaatt
cttgtaactcttattcatgagatgcaaaaaagacaggcgaaaaaaggccttgcaactcta
tgcatcggcggtggccagggggtagccacggtggtggagcttgcatag

DBGET integrated database retrieval system