KEGG   Boseongicola sp. CCM32: E2K80_13660Help
Entry
E2K80_13660       CDS       T05925                                 

Definition
(GenBank) class II aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
boo  Boseongicola sp. CCM32
Pathway
boo00051  Fructose and mannose metabolism
boo01100  Metabolic pathways
boo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:boo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    E2K80_13660
Enzymes [BR:boo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     E2K80_13660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: QBY01643
Position
2809745..2810398
Genome map
AA seq 217 aa AA seqDB search
MNPDSEDALRQSIIDSCLWMNTSGLNQGTSGNISVRCGDHMIITPSGIPYDQLHPDMLCC
VPLNADPNPVARNRPSSEWRFHQALLNAKPDQSVVVHAHPAHVTAIAVQRRSIPACHYMI
AAFGGDDVPLVDYALFGSSELAELVTKAMAERSGCLMANHGAITTGNSLARALWRMEELE
NLARVYLLAQSCGTPKILSNAEMAEVVEAFGDYGPTD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagattctgaggatgctctacgccaatccatcatagatagctgcctttggatg
aacacgagcggattgaatcagggaacatccggcaacatctccgtgcgctgcggcgatcac
atgattatcacaccttccggcattccttacgaccagttgcacccagacatgctttgctgc
gtcccgctgaacgcagatccgaatccggtcgcgcgcaatcgacccagcagcgaatggcgg
tttcaccaagcacttttgaatgcaaagcccgaccagtcagtcgtcgtccacgcccatccc
gcgcatgttacagctattgcggttcagaggcgcagcattcccgcctgccattacatgatc
gccgcgtttggtggagatgacgtgcctttggtcgattatgcgctgtttggcagctcggaa
ttggctgaactggtcacaaaggcaatggcagaacgcagtgggtgtctcatggcgaaccac
ggcgcaataacgaccggaaacagcctcgcacgcgccttgtggcgtatggaagaattagaa
aacctggcgcgtgtgtatttgttggcgcaatcctgcggaacaccaaaaatcctaagcaac
gcagaaatggcggaagtggtagaagcctttggcgactacgggcctacggactga

DBGET integrated database retrieval system