KEGG   Bosea sp. PAMC 26642: AXW83_07435Help
Entry
AXW83_07435       CDS       T04264                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bop  Bosea sp. PAMC 26642
Pathway
bop00450  Selenocompound metabolism
bop00970  Aminoacyl-tRNA biosynthesis
bop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bop00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AXW83_07435
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AXW83_07435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bop01007]
    AXW83_07435
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bop03016]
    AXW83_07435
Enzymes [BR:bop01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AXW83_07435
Amino acid related enzymes [BR:bop01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AXW83_07435
Transfer RNA biogenesis [BR:bop03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AXW83_07435
 Prokaryotic type
   Other AARSs
    AXW83_07435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AMJ63519
UniProt: A0A126P3E9
Position
1588708..1590282
Genome map
AA seq 524 aa AA seqDB search
MAKAPKFYLTTAIHYTNGPPHIGHAYEMVASDAIARFKRLDGYDVFAMTGTDEHGQKVQR
TAAQAGLEPKAYVDGIAHRFQEMEERLNCSFDRFIRTTDADHLPSTQELWRRMEANGDIY
LAKYAGWYSVRDEAFYGEEETTLLADGSRLGGQGTPVEWVEEESYFFRLKSYQDRLLKLY
EEVPDFISPPTRRNEIVSFVKSGLEDLSISRTTFDWGLPVPGDPKHVMYVWVDALNNYVT
GTGFPDPEDPRAHYWPADVHIIGKDIVRFHTVYWPAFLMSAGLPLPKRVFGHGFLLTKGE
KMSKSLGNVVDPFELADTYGVDQLRYFFLREVSFGQDGNYSHEAIVGRINADLANDLGNL
AQRSLSMIAKNCEGRVPVCGTLAEADEAMLALADGALAKARTAMTDFALHVLLAEIWAVV
AEANRYFAANEPWRLSKSDPARRDTVLYVTAEVIRQVAILVQPVMPDAMAKLLDLLAVAA
DARSFAALGEGGRLTAGTALPAPTGVFPRYVEPEAGQDASGKGA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggccccgaaattctatctgacgaccgccattcactacacgaatggcccgcct
catatcggccacgcctatgagatggtggcgtcggacgcgatcgcgcgcttcaagcggctc
gacggctacgacgtcttcgcgatgacgggaaccgacgagcacggccagaaagtacagcgg
acggcggcgcaggccgggctcgagccgaaagcttatgtcgacggcatcgcccatcgcttc
caggagatggaggagcggctgaactgctccttcgaccgctttatccgcaccaccgacgcc
gaccatctgccctcgacgcaggaactgtggcggcggatggaagccaatggcgacatctac
cttgcaaagtatgccgggtggtactcggtccgcgacgaggccttctacggcgaggaggag
accacgctcctggctgacggctcgcggctgggcgggcaggggacgccggtcgaatgggtc
gaggaggaaagctatttcttccgcctcaaatcctatcaggaccggctcctgaagctctat
gaggaggtgccggacttcatctcgccgccgacgcgccgaaacgaaatcgtctccttcgtg
aagagtgggctcgaggatctctcgatcagccgcacgaccttcgactggggcctgcccgtg
ccgggcgaccccaagcacgtgatgtatgtttgggtcgacgcgctcaacaattacgtcacc
gggacgggctttcccgatccggaggatccgcgcgcgcattactggccggccgatgtccac
atcatcggcaaggacatcgtgcgctttcacactgtctactggccggccttcctgatgtcg
gccggcctgccgctgcccaagcgggtcttcggccatggcttcctgctcaccaagggcgag
aagatgtcgaagtcgctcggcaatgtcgtcgatcccttcgaactggccgatacctatggt
gtcgatcagctgcgctatttcttcctgcgcgaggtctccttcggccaggacggcaactac
agccatgaggcgatcgtcggccgcatcaatgccgatctcgccaacgatctcggcaatctg
gcccagcgctcgctctcgatgatcgccaagaactgcgagggccgggtgccggtctgcggg
acgctggcagaggccgatgaggcaatgctcgcgctcgccgacggcgcacttgccaaggcg
cgcacggcgatgacggatttcgccctgcatgttctgctcgccgaaatctgggccgtcgtg
gccgaggccaaccggtatttcgccgctaacgaaccctggcgcctgagcaagagcgatccg
gcgcgtcgcgacactgtgctttacgtcaccgccgaggtgatccggcaggtcgcgatcctc
gtccagccggtgatgccggacgccatggccaagttgctcgacctgctcgccgtcgcggcc
gatgcgcgcagctttgccgcgctcggcgaaggcggccggctgaccgcaggcacggcactg
cccgctcccaccggcgtcttcccgcgctatgtcgagccggaggccggccaggacgcgtcg
ggcaagggcgcctga

DBGET integrated database retrieval system