KEGG   Bosea sp. PAMC 26642: AXW83_16315Help
Entry
AXW83_16315       CDS       T04264                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bop  Bosea sp. PAMC 26642
Pathway
bop00071  Fatty acid degradation
bop00072  Synthesis and degradation of ketone bodies
bop00280  Valine, leucine and isoleucine degradation
bop00310  Lysine degradation
bop00362  Benzoate degradation
bop00380  Tryptophan metabolism
bop00620  Pyruvate metabolism
bop00630  Glyoxylate and dicarboxylate metabolism
bop00640  Propanoate metabolism
bop00650  Butanoate metabolism
bop00900  Terpenoid backbone biosynthesis
bop01100  Metabolic pathways
bop01110  Biosynthesis of secondary metabolites
bop01120  Microbial metabolism in diverse environments
bop01130  Biosynthesis of antibiotics
bop01200  Carbon metabolism
bop01212  Fatty acid metabolism
bop02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXW83_16315
   00630 Glyoxylate and dicarboxylate metabolism
    AXW83_16315
   00640 Propanoate metabolism
    AXW83_16315
   00650 Butanoate metabolism
    AXW83_16315
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXW83_16315
   00072 Synthesis and degradation of ketone bodies
    AXW83_16315
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXW83_16315
   00310 Lysine degradation
    AXW83_16315
   00380 Tryptophan metabolism
    AXW83_16315
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AXW83_16315
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXW83_16315
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AXW83_16315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bop04147]
    AXW83_16315
Enzymes [BR:bop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AXW83_16315
Exosome [BR:bop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXW83_16315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C Ketoacyl-synt_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMJ61661
UniProt: A0A126P174
Position
3380729..3381910
Genome map
AA seq 393 aa AA seqDB search
MADSDIVIVGAARTAVGAFNGAFANTPAHELGAAAIKEALARAKVDPADVDEVIMGQVLT
AGQGQNPARQAAMAAGIPQEASAWGLNQLCGSGLRAVAIGLQQIANGDADIIVAGGQESM
SMSQHGAHLRNGTKMGDLKFIDTMLKDGLWDAFHGYHMGTTAENVATKWQISREEQDGFA
TRSQNKAEAAQKAGRFKDEIVPFTVSTRKGDIVVSDDEYPRHGATVEAMAKLKPAFSKDG
TVTAGNASGINDGAAALVIMSAKEAAKRGLKPLAKIAGWATAGVDPAIMGSGPIPATRKA
LEKAGWKVSDLELVEANEAFAAQAIAVNKDLGWNTDIVNVNGGAIAIGHPIGASGARVLV
TLLHEMEKRDAKKGLATLCIGGGMGVALAVERA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctgattcagatatcgtgatcgtcggcgcggcgcgtacagcggtcggtgccttcaac
ggcgccttcgccaacacccctgcccatgagctgggcgccgccgcgatcaaggaggcgctc
gcccgcgccaaggtcgaccccgccgatgtcgacgaggtcatcatgggccaggtcctgacc
gccggccagggccagaaccctgcacgccaggcggccatggccgcaggcatcccgcaggag
gcgagcgcctggggcctgaaccagctctgcggctcggggctccgcgccgttgcgatcggt
cttcagcagatcgccaatggcgacgccgacatcatcgttgccggcggccaggaatcgatg
tcgatgtcgcagcacggcgcgcatctgcgcaacggcaccaagatgggcgacctgaaattc
atcgacacaatgctgaaggacggcctttgggacgccttccacggctatcacatgggcacc
accgccgagaacgtcgcgaccaaatggcagatcagccgcgaggaacaggacggtttcgcg
accaggtcgcagaacaaggccgaggccgcgcagaaggccggcaggttcaaggacgagatc
gtccccttcaccgtctcgacccgcaagggcgatatcgtcgtcagcgacgacgagtacccg
cgccatggcgcgaccgtagaggccatggccaagctgaagcccgccttctcgaaggacggc
acggtcaccgccggcaacgcctcgggcatcaatgacggcgccgccgcgctggtgatcatg
agcgccaaggaagccgccaagcgcggcctcaagccgctggcgaagatcgccggctgggcg
acggcgggcgtcgatcccgcgatcatggggtcgggcccgatcccggcgacccgcaaggcg
ctggagaaggccggctggaaggtctcggatctcgagctcgtcgaggccaacgaggccttc
gccgcccaggccatcgcggtcaacaaggacctcggctggaacaccgacatcgtcaacgtc
aatggcggcgcgatcgcgatcggccatccgatcggcgcgtccggcgcccgcgtgctcgtc
acgctgctgcacgaaatggagaagcgcgacgccaagaagggcctcgcgacgctttgcatc
ggcggcggcatgggcgtggcgctcgcggtcgagcgggcctga

DBGET integrated database retrieval system