KEGG   Bosea sp. PAMC 26642: AXW83_16515Help
Entry
AXW83_16515       CDS       T04264                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bop  Bosea sp. PAMC 26642
Pathway
bop00260  Glycine, serine and threonine metabolism
bop01100  Metabolic pathways
bop01110  Biosynthesis of secondary metabolites
bop01120  Microbial metabolism in diverse environments
bop01130  Biosynthesis of antibiotics
bop01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AXW83_16515
Enzymes [BR:bop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AXW83_16515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AMJ61696
UniProt: A0A126NXW3
Position
3424141..3425202
Genome map
AA seq 353 aa AA seqDB search
MNFISDNTAGASAPVMAAIAAANDGNASAYGTDAWTVRVEALFAEIFEHEVAVFLVTSGT
AANALALASITRPWGAVLTHEESHVADDECGAPEFFSDGAKLLGLPGTGNKLSPDIVTQT
LARFREGALHQVQPQAVSITQATECGKIYTVEEVHALKEAAATRRLTLHMDGARFANALV
TLGCTPAEITWKAGVDVLSFGGTKNGAWAAEAVIFFDPAQAAEMKWRRKRAGHALSKGRL
IGAQFEGLLTGGHWLDLARHANTMATRLAEALAAQNIPLAWPCQANEVFPILSAALQETL
KNAGVGYLPWSQTALARDTVLPDGAVIGRFVMSFATKPEDVTRLIEVFAAAQG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcatcagcgataacaccgccggcgccagcgcccctgtcatggcagcgatcgct
gccgcgaacgacggcaacgcctccgcctatggcaccgacgcgtggaccgtccgcgtcgag
gcgctctttgcggaaatcttcgaacacgaggtcgcggtcttcctcgtcaccagcggcacg
gcggccaatgcgctggcgctcgccagcatcacccgcccctggggcgcggtgctgacccat
gaggaaagccacgtcgccgacgacgaatgcggcgccccggagttcttcagcgacggcgcc
aagctccttggcctgcccggtaccggcaacaagctctcgcccgacatcgtcacccagacc
ctcgcccggttccgcgagggcgcgcttcatcaggttcagccgcaggccgtctcgatcacc
caggcgacagaatgcggcaagatctacaccgtcgaagaggttcacgccctgaaagaggcc
gccgccacgcgccgcctcacgcttcacatggacggcgcccgcttcgcgaatgcgctggtg
acgctgggctgtacgccggccgagatcacctggaaggcaggcgtcgacgtgctctctttc
ggtggcaccaagaacggcgcctgggcggctgaagccgtgatcttctttgatccggcgcag
gcggccgaaatgaaatggcggcgcaagcgcgccggccacgccctgtcgaaaggccggctg
atcggcgcgcaattcgagggtttgctgaccggcggccattggctcgacctcgcccgccac
gccaataccatggcgacgcgtctcgcggaggcactggcggcccagaatatcccgctcgcc
tggccctgccaggccaacgaagtgtttccgatcttgtcggcggcgctgcaggagacgctg
aagaacgcgggcgtcggctatctgccctggtcgcagacggcgctggcgcgggacaccgta
cttccggacggtgctgtgatcggccgcttcgtgatgtcgttcgccactaaacccgaggat
gtcacgcggctgatcgaggtcttcgccgccgcgcagggctga

DBGET integrated database retrieval system