KEGG   Bosea sp. PAMC 26642: AXW83_23520Help
Entry
AXW83_23520       CDS       T04264                                 

Definition
(GenBank) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bop  Bosea sp. PAMC 26642
Pathway
bop00970  Aminoacyl-tRNA biosynthesis
bop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bop00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AXW83_23520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bop03029]
    AXW83_23520
Enzymes [BR:bop01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AXW83_23520
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AXW83_23520
Mitochondrial biogenesis [BR:bop03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AXW83_23520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AMJ62868
UniProt: A0A126P1R4
Position
complement(4905189..4906607)
Genome map
AA seq 472 aa AA seqDB search
MTALHDLTIAEAAPLLKARKLSPVELTASYLSRIEAFDGQLNAYLRVLPEQAVAAARKAE
SEIMNGGYKGALHGVPIGLKDIYNTKGIPTTGHSALYKDHVPEEDATTTRLLAEAGTILL
GKLSTWEFAIGGTSFDLPWPPAKNPWNLAHDPAGSSSGSGAAIAAGLAMGSMGTDTGGSI
RGPAAWCGISGLKPTYGLVSRRGILPLSFSLDHGGPMCWTSEDCALMMDVLAQHDPLDPG
SADVAKPDFAGSLQKDVKGLRIGVVRHFFETDAEIDPEITAGIEAALTIFGDLGCSVIDV
TLSPLSVYGDVAALISRSEAFAFHEETLKATPELYGELARQRIMMGAFVRACDYVNALRE
RGRLIAEIATVFEGVDVLICPTMPGVAPKLGDLGNMMSRSRPSFTRVFNLTGSPALSVCS
GFSAAGLPLNMQIVGRPFQDDLVLRVGSAFERATAFRDLRPAQWAQHAMAAE
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgctgcacgatctgaccatcgccgaggccgctccgctgctgaaggccaggaag
ctctctccggtcgaattgaccgcgtcttatctctcccggatcgaggccttcgacgggcag
ctcaacgcatatctccgtgtgctgcccgagcaggcggtggccgcggcgcgcaaggccgaa
agcgagatcatgaatggcggctacaagggcgcgctccatggcgtgccgatcggcctgaag
gacatctacaacaccaagggcatcccgacgaccggccattccgccctctacaaggaccat
gtcccggaggaggacgccaccacgacgcgactgctggcggaggccggcaccatcctgctg
ggcaaactctcgacctgggaattcgccatcggcggcacgtctttcgacctgccctggccg
ccggcgaagaatccctggaaccttgcccatgatccggcaggctcgtcttcggggtcgggc
gccgcgatcgcggccgggttggcgatgggctcgatgggcaccgataccggcggctcgatc
cgcggccccgccgcctggtgcgggatttcggggctgaagccgacctacgggctggtcagc
cgacggggcatcctgccgctttccttcagcctcgaccatggcggaccgatgtgctggacg
agcgaggactgcgcgctgatgatggacgtgctggcgcagcacgacccgctcgatcctggc
agcgccgacgtcgccaagcccgatttcgccggctccctgcagaaggatgtgaaggggctg
cgcatcggcgtcgtcaggcatttcttcgagacggacgccgagatcgatcccgagatcacg
gcgggcatcgaggcggcgctgaccatcttcggcgatctcggctgctcggtgatcgacgtc
acgctgtcgccgctgtcggtttatggcgacgtcgcggccctgatctcgcgctcggaagcc
ttcgccttccacgaggaaacgctgaaggcgacgccggagctttacggcgagcttgcccgc
caacgcatcatgatgggcgccttcgtgcgggcctgcgactatgtcaacgcgctgcgcgag
cgcggccgcctgatcgccgagatcgcgaccgtgttcgagggcgtagacgtcctgatctgc
ccgaccatgccgggcgtggcgcccaagctcggcgatctcggcaacatgatgtcgcgctcg
cggccctccttcacccgcgtcttcaatctcaccggctcgccggccctgtcggtctgctcc
ggcttctccgcggcggggcttccgctcaacatgcagatcgtcgggcgccccttccaggac
gatctcgtgctgcgcgtcggcagcgccttcgagagggcgaccgccttccgcgatctgcgc
ccggcccaatgggcgcagcatgccatggcggccgagtga

DBGET integrated database retrieval system