KEGG   Bipolaris oryzae: COCMIDRAFT_102635Help
Entry
COCMIDRAFT_102635 CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
bor  Bipolaris oryzae
Pathway
bor00020  Citrate cycle (TCA cycle)
bor00640  Propanoate metabolism
bor01100  Metabolic pathways
bor01110  Biosynthesis of secondary metabolites
bor01130  Biosynthesis of antibiotics
bor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCMIDRAFT_102635
   00640 Propanoate metabolism
    COCMIDRAFT_102635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bor04147]
    COCMIDRAFT_102635
Enzymes [BR:bor01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     COCMIDRAFT_102635
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     COCMIDRAFT_102635
Exosome [BR:bor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCMIDRAFT_102635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A VID27_N
Motif
Other DBs
NCBI-GeneID: 19118122
NCBI-ProteinID: XP_007690733
JGI: Cocmi1_102635
UniProt: W6YTH7
Position
Unknown
AA seq 443 aa AA seqDB search
MYNLARARPLARAVRAAAETPLKRSVIQQRRGLAIHEYRSAALLESYGIGVPKGGVATSG
AEAEKIAQDIGGEDAVIKAQVLAGGRGKGTFDNGFKGGVRVVYSPREAAILAEQMIGHKL
ITKQTGAAGRLCNSVFIVDRKFARREFYLAILMDRASQGPVIVASSQGGMDIETVAKEHP
EAIITTPIDIHKGVTDEVARNIATELGFSEQCIEDAKDTIQKLYKVFMEKDATQIEINPL
SETTDHQVLAMDAKLNFDDNADFRQKEVFDWRDITQEDPDEVKAAKVGLNFIKLDGDIGC
LVNGAGLAMATMDIIKLNGGAPANFLDVGGGATPEAIRQAFELITSDPKVTAIFVNIFGG
IVRCDAIAKGLIQVVQEMNLKTPVIARLQGTNMEAAQKLINDSGLKIFSIDDLQGAAEKS
VQFSKVVKMARDIDVGVEFTLGI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccttgcccgcgcccggccgctggctcgcgctgttcgcgctgctgctgagaca
ccactgaagcgctcagtcatccaacaaaggagaggcctcgccatccacgaatacaggtcc
gcagccctgctcgaatcgtatggcattggcgtgcccaagggcggcgtcgctaccagcggc
gctgaggctgagaagattgcccaggacattggcggagaggacgccgtcatcaaggcccag
gttcttgccggaggccgtggaaagggaacctttgacaacggcttcaagggcggtgtcagg
gttgtctactctcctcgcgaagcagccatccttgccgagcagatgatcggccacaagctc
atcaccaagcaaaccggagccgccggccggctctgcaactctgtcttcattgtcgaccgc
aagtttgctcgccgtgagttctacctcgccatcctcatggaccgcgcttcccaaggcccc
gtcattgtcgcttcgtcacagggtggtatggacatcgagaccgtcgcaaaggagcacccc
gaggccatcatcaccacccccattgacatccacaagggcgtcaccgacgaagtggcgcgc
aacattgcgaccgagcttggtttctcagagcagtgcatcgaggatgccaaggacaccatc
cagaagctgtacaaggttttcatggagaaggacgctacccagatcgaaatcaaccccctc
tctgagactaccgaccaccaggtcctcgccatggacgccaagctcaactttgacgacaac
gccgatttccgtcagaaggaggtctttgactggagggacattacccaggaagaccccgac
gaggtcaaggccgccaaggttggtcttaacttcatcaaactcgacggtgacattggttgc
ctcgtaaacggtgccggtctggccatggctaccatggacattatcaagctcaacggtggc
gcgcccgctaacttcttggatgtcggtggcggtgctaccccggaggccatcaggcaagct
ttcgaactcatcaccagcgaccccaaggtcactgccatttttgtcaacatctttggtggt
atcgtccgctgtgacgccattgccaagggtctcatccaggttgtccaggaaatgaacctc
aagactcctgttattgctaggttgcagggtaccaacatggaggctgcacagaagctgatc
aacgactctggtcttaagattttctccatcgatgatctccagggtgcggctgagaagtcc
gtccagttctcaaaggttgtcaagatggcacgtgatatcgacgttggtgttgagttcact
ctgggtatctaa

DBGET integrated database retrieval system