KEGG   Bipolaris oryzae: COCMIDRAFT_108927Help
Entry
COCMIDRAFT_108927 CDS       T03125                                 

Definition
(RefSeq) glycoside hydrolase family 32 protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bor  Bipolaris oryzae
Pathway
bor00052  Galactose metabolism
bor00500  Starch and sucrose metabolism
bor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    COCMIDRAFT_108927
   00500 Starch and sucrose metabolism
    COCMIDRAFT_108927
Enzymes [BR:bor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     COCMIDRAFT_108927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 19119334
NCBI-ProteinID: XP_007693086
JGI: Cocmi1_108927
UniProt: W6YS98
Position
Unknown
AA seq 624 aa AA seqDB search
MTSHMLVTATPITPFQFKKVPRVSVFSTPLVSETTPEPKERWRPRLHLVAPRGWLNDPCA
PGYDPVNKRYHLGFQWNPNSTEWGNISWGAAVSHDLLTWKVSDRPSMQPSAQCDSGGVFT
GCLVPTAIDGSENGVLTAAYTSVSRLPIHYTQPYFRTSEAVALATSTDSGRTWTRYANNP
VLAEPPPGIDVTGWRDPFVAPWPRMDKLVNQQRVNQDTRSLYAVVAGGVRGKTPTAFLYR
VDANALDLWQYLGPLIAPGLNFCPSPRWTGDFGVNWEVSNFVSLTSGDGKICRDFLICGV
EGRLATDEMIRTKGNFRATNAQMWLCGSLESAPGVHMKFGFGGRLDHGLYYAGNSFWDPQ
TQQQVIYGWIREDDLDAELRRRQGWAGVISSPRVLKMQALTGVTGALLSPLQSIGSVELV
PEDTEGSSFTVVTLCAVLDPRLRKLRGCRFPSRETSGQSSGGAFVFPMAWSQWEMELEFR
MEEGAAKLGFDIVHSAVEFTRVYFDANAETIIIDRSCSTSLDGIRTCREEAPHTLFRIRQ
QGKDSPFTEKGILETLQFHVLYDSSVLQVFVNERTALTTRVYPVGGTSTGIRPLVERTGN
HSSNTGGPKSRGWNMALWPLSLLV
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacacatgctagtaactgcaacccccatcactcctttccaattcaaaaaggtc
cccagagtgagtgtattctctacacctctggtctccgaaacgacgcctgaaccgaaggaa
cgatggcgaccacgcctacatctcgtggctcctcgtggctggctcaacgacccttgcgcc
cctggatacgacccggtcaataagaggtatcacctaggttttcagtggaatccaaacagc
acagaatggggcaacatttcctggggtgcagcagtatcccacgatctcctcacatggaaa
gtctcagatcgcccatctatgcagccctctgcacagtgcgattctggcggcgtgttcacc
ggctgtcttgtacccactgcaatcgatggatcagagaacggcgttctaacagcggcgtac
acatcagtgtcccgcctcccgattcactacacgcagccatatttccgaacatcagaggca
gtcgctttggctacatcaaccgactctggcaggacatggactaggtatgcaaataaccct
gtcctcgcagagcctccgccgggcatcgacgtcaccggctggcgagatccgttcgtagct
ccctggccacgcatggataaactcgtcaatcagcaacgggtgaaccaagacaccagatct
ttgtatgctgtcgtggcaggaggagttcgagggaagacaccaacagcctttctctaccga
gtggatgccaatgcactggatttatggcaataccttggccctttgatcgcccctggcttg
aacttttgcccttcgccgcgctggacaggagattttggcgtgaactgggaggtgagtaat
tttgtatccctgacgagtggagatggcaagatatgtcgtgactttctcatttgtggcgtc
gaaggtcggttagctaccgatgaaatgattcgcaccaaaggcaacttccgagcgaccaat
gcgcaaatgtggctttgcggtagcctcgagagtgcgccgggggtgcacatgaaattcggg
ttcggaggcagattggaccatggtctatactatgctggcaactcgttctgggatccgcaa
acgcagcagcaagtcatatacggctggatccgcgaagatgacctcgatgcagagctccgt
cggcgacagggatgggctggtgttatctcgtcgccacgagttctcaagatgcaggccttg
acgggtgtcaccggagccctgctatctccacttcaatctatcggctccgtcgaattggtg
cctgaagatacggagggctcgagcttcactgtcgtcacgttgtgcgcagttctcgaccct
cggttacgcaagctacgaggctgtagatttccctcgagggaaacctcggggcaaagctca
ggcggggcttttgtgtttcctatggcctggtcgcagtgggagatggaactagaatttaga
atggaagaaggcgctgccaagctggggtttgatattgtacattcagctgtggagtttacc
cgcgtttactttgatgcgaatgcggagacgattatcattgaccggagttgctccacatcg
ctagatgggatccgaacatgtcgagaggaagcgccccacacactgttcaggattaggcag
cagggcaaagacagcccctttaccgaaaaggggatactcgaaaccttgcagttccatgtc
ctgtacgactccagcgtgcttcaggtctttgtgaacgaacgcacagcactgaccacgagg
gtttatcccgttggcgggacgagcacgggtatccgcccgttggtggagcgaacaggtaat
cattctagcaacactggagggccgaagtctcggggttggaatatggctctgtggcctctc
tcgcttcttgtctaa

DBGET integrated database retrieval system