KEGG   Bipolaris oryzae: COCMIDRAFT_2274Help
Entry
COCMIDRAFT_2274   CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
bor  Bipolaris oryzae
Pathway
bor03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bor00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    COCMIDRAFT_2274
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bor03400]
    COCMIDRAFT_2274
Enzymes [BR:bor01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     COCMIDRAFT_2274
DNA repair and recombination proteins [BR:bor03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     COCMIDRAFT_2274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_N DNA_ligase_A_M BRCT_2 DNA_ligase_A_C RNA_ligase LIG3_BRCT BRCT Bac_globin
Motif
Other DBs
NCBI-GeneID: 19120319
NCBI-ProteinID: XP_007684583
JGI: Cocmi1_2274
UniProt: W6ZG11
Position
Unknown
AA seq 993 aa AA seqDB search
MAEDTPMPDADAVRENTLMYSHDDDLDEKYPLRPLNLHKTLPFHTLFTDLFNPLMDTQKK
KQSVGPRRKVGPHGRGNLTPHEAKRNIVERFIANWRKQVGNDFYPAMRLIIPEKDRERAM
YGLKEKTIAKILIKLTRIGKDSDDAKHMLNWKLPSQLQKASAWSAGDFAGRCYEILASRQ
LKTEYSDMSIAEVNNALDKLSQVGTEEEQVKIFQRFYRRMNAEEMTWLIRMILRQMKIGA
TEKTLLDIWHPDAETLFNVSSNLRRVCWELFDHNIRLEGENTGLSLMQCFQPQLAQFQDK
VGSFQKMVTRFKGDSDDDTFWIEEKLDGERMQLHMVEDPEAPGGKSFGFWSRKAKDYTYL
YGKHFHGDEAGALTRFITDAFGKNVKNIILDGEMVTWDMETDHIVGFGTLKTAAISEKEN
KTNQETGQRPLFRVFDCVYLNDMLLTQYTLRDRRRALESAVKGVHRRLEVHPYIEARSHT
EIEPALRKVVAEASEGLVLKNPRSMYCLNQRNNDWMKVKPEYMSEFGESLDCIVVGGYFG
SGRRGGAHSSFLCALLTNKSAKPGDPKHEHCWSFFKVGGGFSSDDYAALRGRTQGKWHDW
DPRRPPPFIELGGHEQNRQHERPDQWIRPSDSVVLECKAASIESSDKFRFALTLRFPRFK
QLRTDKRWDQALSVQEFLEVKTKVEIEKSEKEKEFKIEQSRRKKARASRKPLAVMGNDTV
TTPYAGPESKIFDGLSFYVMTEQIYPVKKSKADLEVLIKANGGKLIQRDSTDKNLIIIAD
KRLIKVASLEKRATNNIVKPVWIQDCIAQNEADTGALPYLLPFEPNRHMFYLHDDDQFEI
ESNVDENGDPYARDITTVEEMRKLLDGMAKPESPATFQRQGFLKQLEDHGKPLEQLKTHM
FHSVKALFPDDVDNKDWSLKAQLAKNYLRFGDGLIADDEEEEGITHIIVPDERSSSRISN
ARISGLARIVGIGWVEKCLKEGTRLDEERYQWG
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagatacgccaatgccggatgcagacgccgtacgggaaaatactctcatgtac
agccatgatgatgacttggacgagaaatacccgctgcggcctttgaatttacacaagaca
ctgccgtttcacacattgttcactgatcttttcaacccgctcatggacacgcaaaaaaag
aagcagtcggttggcccccggcgtaaggttggaccgcacggccgcggcaacctaacgcct
catgaagccaagcggaacatcgtcgagcgctttattgcgaattggcggaagcaggtgggg
aatgacttctatcctgcaatgcgcctcattattcccgagaaagaccgagagcgcgccatg
tacggtctgaaagagaagacaatagcaaaaatcttgatcaagcttacgagaattggcaag
gattcagatgatgcaaagcacatgctcaactggaaattgcctagtcagctgcaaaaggca
tcagcttggtctgctggtgactttgccggacggtgctatgagattctagcgtcacggcaa
ctcaagacagagtatagcgacatgagcattgcggaagtcaacaatgctctcgacaaacta
tcgcaagtcggtaccgaagaagagcaagtcaaaatcttccaaagattttaccgaaggatg
aatgccgaggaaatgacatggcttattcggatgattctccgtcagatgaagattggcgcg
actgagaagaccttgcttgatatctggcatccagatgcggaaacattattcaacgtgtcg
tcgaatcttcggcgtgtttgttgggagctttttgatcacaacatacgtcttgagggcgag
aatactggtcttagtctcatgcaatgcttccaaccgcaactagctcaatttcaggacaaa
gtaggctcgttccagaagatggttaccaggttcaaaggagattcagatgatgatacattc
tggattgaggagaaactcgacggtgaacgcatgcagctacacatggtagaggacccagaa
gcgccgggtgggaagtcgtttggcttctggtcgcgaaaggcgaaagactacacttatctc
tatggaaaacatttccacggcgacgaagctggagcactcacgcggttcataacagatgcg
tttggaaagaacgtgaagaacattatcctagacggcgaaatggttacctgggacatggag
actgatcacattgtcggttttggcactctcaagactgcagccatatccgagaaggagaac
aagacaaaccaagagactggccagcggccactgtttcgagtgtttgattgtgtgtacctg
aacgatatgttgctcacccagtatacgcttcgtgatcgccgtcgtgctctggaaagcgct
gtcaaaggtgtacaccgcagattagaagttcatccatacatcgaggcgcgttcgcatact
gagatcgagccggcgctgcggaaagtggttgctgaagcatccgagggcttggtgttaaag
aaccctcgctcaatgtattgcttgaatcaacgaaataacgattggatgaaggtgaagcca
gagtacatgtccgagtttggagagtctcttgactgcattgtcgttggagggtactttggc
tctggtcgccgtggaggtgctcactcatcttttctttgtgcactactcacgaacaagagc
gcaaagccaggagaccccaaacacgaacattgttggtcattcttcaaggttggtggtgga
tttagctcggacgactacgctgctttacgaggacgaacgcaaggaaaatggcatgattgg
gatcctcggcgtccaccgccattcatcgaactaggtggccacgagcagaatcggcaacat
gaaagaccggaccaatggattagaccaagtgactctgtcgtactggagtgcaaagccgcc
agcatcgagagcagtgacaagttccgctttgcattgacactccgctttccacgcttcaag
cagctcaggacagacaaacgatgggatcaggcactttccgtacaggagttccttgaagtc
aaaaccaaagtagagattgagaaatctgagaaggagaaggaattcaagatcgaacagtca
cgacgcaagaaagcgcgtgcatcgaggaagccgttggcagtgatgggcaacgatacggtg
acgacaccatatgcaggcccagagtctaaaatcttcgacgggctcagcttctacgtcatg
actgagcagatatacccagtgaagaaatccaaagctgacctagaggtgctcatcaaagcc
aatggtggcaaacttatccaacgcgactctacagacaagaatcttatcatcattgccgac
aaacggctgatcaaagttgcgtcgctggaaaagcgagctacaaacaacattgtcaagccg
gtctggatccaagactgtattgcacaaaatgaagcagacactggcgcattgccctaccta
cttccttttgaaccgaacaggcacatgttttacctccacgatgacgatcagttcgaaatt
gagagtaacgtagatgaaaatggcgatccttacgcacgcgatattacgaccgtggaagag
atgaggaaattgctagatgggatggcgaaaccggaaagtccagctacgttccagcgacaa
ggatttttgaaacagctggaagatcatggcaagcctttggagcagctgaagacccatatg
tttcactctgtcaaggctttattcccagatgatgtggataacaaagattggtcgttgaag
gcgcaactggcgaagaactatctccgttttggagatgggctgattgccgacgacgaggaa
gaagaggggatcacgcacatcatcgtaccagacgaaagatcttcatccaggatatcgaat
gcaagaatctctggacttgctcgaatagttggtataggatgggtggaaaagtgcttgaaa
gaaggtacaagacttgatgaagagagatatcagtggggatag

DBGET integrated database retrieval system