KEGG   Bipolaris oryzae: COCMIDRAFT_28982Help
Entry
COCMIDRAFT_28982  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
bor  Bipolaris oryzae
Pathway
bor00564  Glycerophospholipid metabolism
bor00565  Ether lipid metabolism
bor00590  Arachidonic acid metabolism
bor00592  alpha-Linolenic acid metabolism
bor01100  Metabolic pathways
bor01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    COCMIDRAFT_28982
   00565 Ether lipid metabolism
    COCMIDRAFT_28982
   00590 Arachidonic acid metabolism
    COCMIDRAFT_28982
   00591 Linoleic acid metabolism
    COCMIDRAFT_28982
   00592 alpha-Linolenic acid metabolism
    COCMIDRAFT_28982
Enzymes [BR:bor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     COCMIDRAFT_28982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 19121415
NCBI-ProteinID: XP_007691093
JGI: Cocmi1_28982
UniProt: W6YXU5
Position
Unknown
AA seq 813 aa AA seqDB search
MAGYRNTRNLGQLWLCGTRRGPRAATLGLRYGPPCLLATAATGYLISPYSPYPLLRPIQL
DAPSLKRYIFGGGGDAKTETTSAGDAERQINKEGEGKSGEQDAPPQTRVVRGYGSEDEGD
NRTGESQSAWQTITDKFPKSPSPSKIGDTIIDYIVPNWVKVMPGFIRKLQNELSMAPGSL
AEEIWREANDPEINPEIVWDASVRVSNELCQEEKSFLEKRAHFTKAALARYLDIPEATIH
PDDVPVIAMCGSGGGLRALVAGTSSYLSTKEAGLFDCVTYTAGVSGSCWLQTLYYSELSQ
RSHARMIRHLKNRLGVHIAFPPDALELLVSAPTSKYLLSGLVEKAKGIPDADFGLVDIYG
ALLAARLLVPKGELSVSEYDFKISNQRRFTDNGSQPLPIYTAVRHEIPLAEQSDDKNAIE
AEAQARKEAWFQWFEFTPYEMWCEELSAGIPTWAMGRRFQNGRTVWRDNGLALPEVRVPL
LMGIWGSAFCATLSHYYREIRPLMRSLTGLGSSIDAMIAERDDDLVKVHPIDPAAMPNYA
LGMREFLPPTCPESIFQQKNFQFMDAGMSNNLPIYPLLRPGRNVDILVAFDASADVRTDN
WLKVADGYARQRGIKGWPVGAGWPPADESMEEIQQDLDRAEAKSEQEAQEKLNQAQEKDG
PTKKKIEDLGYCNIWVGTTEERTSDSASPESKQVEEDWELMHPNSGITVIYFPFLANPKA
PGADPKVSDFMSTWNFVYTPEQIDSVVDLARANYNEGAERTKRTVRAVYERKKRQREERE
KEERERRWRWKLSQGRIAGRRIGGDSEHGDQFS
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggccggctataggaacacgcgcaatttgggccaactttggctgtgtgggacgcgtcgt
gggcccagggcagccaccctcggtcttcgctatggccctccttgcctgcttgccaccgct
gccaccggctacttgatatctccgtactctccatacccgctgttacgtcccattcaactc
gatgcgccgtctctcaagcgatacatatttggtggtggtggtgatgccaagactgagacg
acgtccgccggggatgccgaaaggcagattaacaaagaaggtgaaggcaagtcaggagag
caggacgcaccaccccagactcgcgttgtgaggggctacggtagcgaggatgagggcgac
aatcgaaccggagagagccagtccgcctggcagaccatcacggacaaattcccaaagtcg
ccctctccctccaagattggcgataccatcattgactacattgtgcccaattgggtcaag
gtcatgcctggcttcatccgtaagctgcagaatgaactctcaatggccccaggctccttg
gccgaagagatatggcgcgaggccaatgatcccgagatcaacccagagattgtctgggat
gcttctgtcagggtttccaacgagctgtgccaggaagaaaagtctttcttggagaagcgt
gcacacttcaccaaggctgcacttgcccgctaccttgatatcccggaagccacaatccac
cccgacgacgttcccgtcattgcaatgtgcggctctggaggaggactacgcgctcttgtt
gccggcacatcttcatacttatccaccaaggaagcaggcctcttcgattgtgtcacttat
acggcaggagtcagtggcagctgctggctgcagacactctactactcagagctcagtcaa
cgtagccatgctcgtatgattcgtcatctcaagaataggcttggcgtacacattgctttt
cctcctgatgcgcttgaactgctcgtcagtgccccaacgagcaagtatctactaagcggc
ctcgtagaaaaggcaaagggtatcccagacgccgactttggtcttgtagacatctatggc
gctctgcttgctgcacgcttgctcgttcccaaaggcgagctgtctgttagcgagtacgac
ttcaagatatcaaatcagcgacgattcaccgacaatggctcacaaccactcccaatctac
actgccgtacgacacgagattcctctcgccgaacagtcagacgacaagaatgctatcgag
gcagaagcgcaggcgagaaaggaggcctggtttcagtggtttgagtttaccccatatgag
atgtggtgcgaggagctatcggccggtataccaacatgggccatgggtcgccgtttccag
aatggccgaactgtctggcgagacaacggcctagcattgcccgaagtgcgcgtcccactg
cttatgggtatttggggatccgctttctgcgcaacactatcacattattaccgtgaaatt
cgtcctcttatgcgcagcttgacaggtctgggcagtagcatagatgccatgattgcggag
cgggatgatgaccttgttaaagtacatcccatcgatcctgctgcaatgcctaattatgct
ctcggtatgcgcgagtttcttcctccgacctgtcccgaaagcatctttcaacaaaagaat
ttccaattcatggatgctggcatgtctaataacctgcctatctatcccctgctccgacca
ggacgcaacgtggatatacttgttgcctttgacgcttctgccgatgtgagaaccgacaac
tggctcaaagttgccgatggatatgctcggcagcgcgggatcaagggatggccagttggt
gcaggctggccgcccgctgacgaatccatggaagaaattcaacaagacctcgatcgtgcc
gaagccaaaagtgaacaagaagcccaagaaaaactcaatcaggcccaagaaaaggacggt
cccaccaagaagaagattgaggacttgggctactgcaacatctgggtcggaaccactgaa
gagcgtacttctgactctgcatcgccagaaagcaagcaggtcgaagaagactgggagctc
atgcacccaaattctggaatcaccgtcatctactttcccttcctcgccaacccgaaagcg
cctggtgcagatcccaaggtcagcgactttatgtcaacatggaactttgtgtacacccct
gagcaaatcgacagcgttgttgatcttgcgcgggcaaactacaacgagggtgctgagcgc
accaagcgcactgtaagggctgtgtacgagcgcaagaagagacagagggaagagcgggaa
aaggaagagagggagaggcggtggcggtggaagttgagtcagggcaggattgcggggaga
aggattggcggtgatagtgaacatggggatcagtttagctga

DBGET integrated database retrieval system