KEGG   Bipolaris oryzae: COCMIDRAFT_3240Help
Entry
COCMIDRAFT_3240   CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bor  Bipolaris oryzae
Pathway
bor00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:bor00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    COCMIDRAFT_3240
Enzymes [BR:bor01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     COCMIDRAFT_3240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 19122098
NCBI-ProteinID: XP_007685644
JGI: Cocmi1_3240
UniProt: W6ZCT5
Position
Unknown
AA seq 341 aa AA seqDB search
MFARQVFRPARTLHQQVRRYASEAPKSGGNNGVLYTGIGAAGLAGAYLFLRGGDSPSGQK
GNAPPSKEANKIPSSTGGPAKKAFTGGDQGFLSLVLDKSEIVNHNTKKLTFKLPEEDMES
GLPVASAVITKYKGPEMQKPVIRPYTPISDVDQKGTVDFIIKAYPNGPMSEHMHSMEPGQ
RLDIKGPIPKFQWSPNKFEHIALIAGGTGITPMWQTARAIFRNPEDKTKVTLVYGNVTEE
DILLKREFEELENTYPQRFRAFYVLDNPPESWQGGKGYITKELLKTVLPEPKEGEKIKLF
VCGPPGMYKAISGGKKSPSDQGELDGYLKELGYSKDQVYKF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccagacaggtattccgcccggccaggacgctgcaccagcaagtccgccgatat
gcatctgaggcgcccaagagcggcggcaacaatggcgttctttacacaggaattggtgct
gctggtcttgcaggtgcctacttgttcttgaggggtggtgattcaccatcagggcagaag
ggcaatgcaccaccatcaaaggaggccaacaagatcccttcctcaactggtggccctgct
aagaaggccttcaccggaggcgaccaaggcttcctgtcgcttgtgttggacaagtctgag
attgtcaaccacaacaccaagaagctgaccttcaagttgcctgaggaggacatggagagc
ggtctgcctgtagcttctgccgtcatcaccaagtacaagggacccgaaatgcagaagccc
gtcattcgaccgtacactcccatcagcgacgtagaccagaagggcacagtggatttcatc
atcaaggcttaccccaacggacctatgtcggagcacatgcacagcatggagcctgggcag
cgactggatatcaagggacccattccaaaattccaatggtcacccaacaagtttgagcac
attgcgctgattgcgggtggaactggtatcacccccatgtggcagacagcacgcgccatt
ttccgcaaccctgaggataagactaaggtgacgctcgtatacggcaacgtgactgaagag
gacattctgctcaagcgcgagtttgaagagttggagaacacttacccccaacggttccgg
gccttctacgtcttggacaacccaccagagtcgtggcaaggcggtaagggatatattacc
aaggagcttctcaagacagtgcttcctgaaccaaaggagggagagaagatcaagctgttt
gtttgcggaccccctggcatgtacaaggccatcagcggtggcaagaagagcccgtctgac
caaggcgagcttgacggctacctgaaggagcttggctacagcaaggaccaggtgtacaag
ttttag

DBGET integrated database retrieval system