KEGG   Bipolaris oryzae: COCMIDRAFT_33850Help
Entry
COCMIDRAFT_33850  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K17434  large subunit ribosomal protein L53
Organism
bor  Bipolaris oryzae
Brite
KEGG Orthology (KO) [BR:bor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bor03011]
    COCMIDRAFT_33850
Ribosome [BR:bor03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    COCMIDRAFT_33850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53 LBR_tudor
Motif
Other DBs
NCBI-GeneID: 19122421
NCBI-ProteinID: XP_007684731
JGI: Cocmi1_33850
UniProt: W6ZAL1
Position
Unknown
AA seq 98 aa AA seqDB search
MITRFLTDVRVTFNPFSPHSKPARLFLSLIPPDARSDGMKVESKMLPRHSKEPATLGVKF
KDGKEMNLDLTNMRIPQVVEEVDRHSRSLARKEELAGN
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgattaccaggtttcttaccgacgttcgcgtaaccttcaatcccttctccccacactca
aaacccgcccgcctcttcctctccctcataccaccggatgcgcgctcagatggcatgaag
gttgagtctaagatgctaccacgacacagcaaggagcccgcaaccttgggtgtcaagttc
aaagatggcaaggaaatgaacctggatctcacaaacatgcgcatcccacaagtcgtcgag
gaggtagatagacactcacggtcactggcacgaaaagaggagctagcaggcaattag

DBGET integrated database retrieval system