KEGG   Bipolaris oryzae: COCMIDRAFT_33870Help
Entry
COCMIDRAFT_33870  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K05994  bacterial leucyl aminopeptidase [EC:3.4.11.10]
Organism
bor  Bipolaris oryzae
Brite
KEGG Orthology (KO) [BR:bor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bor01002]
    COCMIDRAFT_33870
Enzymes [BR:bor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.10  bacterial leucyl aminopeptidase
     COCMIDRAFT_33870
Peptidases and inhibitors [BR:bor01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   COCMIDRAFT_33870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M28 Peptidase_M20
Motif
Other DBs
NCBI-GeneID: 19122425
NCBI-ProteinID: XP_007684825
JGI: Cocmi1_33870
UniProt: W6ZM19
Position
Unknown
AA seq 390 aa AA seqDB search
MKSTTLLLPLYTAALAAAASSPQDHQAVLQDQQQVTIAEPDEYLIELSPGETRWVTENEK
WELRKQNINFFDITHNKELGTLNRKVSAESVKFPEKPVHKKAIDPLLKELKKENMRAHLE
TFTSFHTRYYKSHYGAESSAWLLSQVNKTLVDAGAVNATVKPFPHPWGQSSIIATIPGKS
DKTIVIGAHQDSINLYFPAFLAAPGADDDGSGTVTILEALRVLLQSPEILAGEAENTIEF
HWYSAEEGGLLGSQAIFQSYERADRNVKAMLQQDMTGYVQKTLDAGEPESVGVITDFVDA
GLTEFIKKIITTYCGIPYVLTKCGYACSDHASASKAGYPSAFVIESDFKYSDNKIHTTED
KIEYLSFDHMLQHARMTLALAYELAFASFE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaacaactctattgctaccgctctacactgctgccttggcggcagctgcttct
tcgcctcaagaccatcaagctgtgctccaggaccagcaacaggtcactatcgccgagcca
gatgagtatctcatcgagctttcgcccggcgagacgcgctgggtgactgagaacgagaag
tgggagttgcgcaaacaaaacatcaacttcttcgacatcacgcacaacaaggagctcggc
acgctgaaccgcaaggtctccgccgagagcgtcaagttcccggagaagcccgtccacaag
aaggccatcgacccgctcctcaaggagctgaaaaaggaaaacatgcgcgcccacctggaa
accttcacctcgttccacacgcgctactacaagtcgcactacggggccgaaagctcagcc
tggctactaagccaagtcaacaaaaccctcgtcgatgccggcgccgtcaacgcaaccgta
aaaccgttcccccacccctggggccaatcctccatcatcgccacaatccccgggaaaagc
gacaagaccatcgtcatcggtgcccaccaagacagtatcaacctgtacttccccgccttc
ctcgccgcaccgggtgccgacgacgacggcagcggcacagtgactatcctcgaggccctc
cgtgtgctgctacaatcccccgagatcctagccggggaggcggaaaacaccattgaattc
cactggtactccgccgaagaaggcggcctgctgggctcccaggcaatcttccaatcctac
gagcgcgcagaccgcaacgtaaaagccatgctgcagcaagacatgactggctacgtgcaa
aagacgctcgacgccggcgaacccgagtctgtgggcgtcatcacggacttcgtcgacgca
ggcctcaccgagtttatcaagaagatcatcactacctactgcggaattccgtatgtacta
acaaagtgtggctatgcatgctcggatcacgccagtgcctcgaaagcgggctacccctct
gcgtttgtaatcgagtcggatttcaagtatagtgataataagattcatacgactgaggat
aagattgagtaccttagctttgatcatatgctgcagcatgcgaggatgacgcttgcgctc
gcatatgagttggcgtttgcgtcgtttgagtaa

DBGET integrated database retrieval system