KEGG   Bipolaris oryzae: COCMIDRAFT_36440Help
Entry
COCMIDRAFT_36440  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
bor  Bipolaris oryzae
Pathway
bor03040  Spliceosome
bor04141  Protein processing in endoplasmic reticulum
bor04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:bor00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    COCMIDRAFT_36440
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    COCMIDRAFT_36440
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    COCMIDRAFT_36440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bor01009]
    COCMIDRAFT_36440
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bor03041]
    COCMIDRAFT_36440
   03009 Ribosome biogenesis [BR:bor03009]
    COCMIDRAFT_36440
   03110 Chaperones and folding catalysts [BR:bor03110]
    COCMIDRAFT_36440
   04131 Membrane trafficking [BR:bor04131]
    COCMIDRAFT_36440
   03051 Proteasome [BR:bor03051]
    COCMIDRAFT_36440
   03029 Mitochondrial biogenesis [BR:bor03029]
    COCMIDRAFT_36440
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bor04147]
    COCMIDRAFT_36440
Protein phosphatases and associated proteins [BR:bor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     COCMIDRAFT_36440
Spliceosome [BR:bor03041]
 Complex B
  Other components
   Prp19 complex
    COCMIDRAFT_36440
 Complex C
   Prp19-CDC5 complex
    COCMIDRAFT_36440
Ribosome biogenesis [BR:bor03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    COCMIDRAFT_36440
Chaperones and folding catalysts [BR:bor03110]
 Heat shock proteins
  HSP70 / DNAK
   COCMIDRAFT_36440
Membrane trafficking [BR:bor04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    COCMIDRAFT_36440
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    COCMIDRAFT_36440
Proteasome [BR:bor03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    COCMIDRAFT_36440
Mitochondrial biogenesis [BR:bor03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    COCMIDRAFT_36440
Exosome [BR:bor04147]
 Exosomal proteins
  Proteins found in most exosomes
   COCMIDRAFT_36440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 19123027
NCBI-ProteinID: XP_007687617
JGI: Cocmi1_36440
UniProt: W6Z258
Position
Unknown
AA seq 646 aa AA seqDB search
MAPAIGIDLGTTYSCVGIFRDDRIEIIANDQGNRTTPSFVAFTDTERLIGDSAKNQVAMN
PTNTVFDAKRLIGRKFADAEVQADMKHFPFKVIDKAGKPVIQVEFKGEEKTFTPEEISSM
VLTKMRETAESYLGGTVNNAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIA
YGLDKKTQGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFT
QEFKRKHKKDLTTNARALRRLRTACERAKRTLSSSAQTSIEIDSLYEGIDFYTSITRARF
EELCQDLFRSTMEPVERVLRDAKIDKSSVHEIVLVGGSTRIPKVQKMVSDFFNGKEPNKS
INPDEAVAYGAAVQAAILSGDTSSKSTSEILLLDVAPLSIGIETAGGVMTPLIKRNTTIP
TKKSEVFSTFSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQIEVTFDVD
ANGIINVSALEKGTGKTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARIAAKNA
LESYAYSLRNTLSDSKVDEKLDAGDKEKLKAEIDKTVAWLDDNQTATKDEYESQQKELEG
VANPIMMKFYGAGGEGGMPGGMPGGAPGGAPGGAGGDDGPTVEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggcacccgcgatcggaatcgatcttggaaccacatactcatgtgtcggcatcttccga
gatgaccgcattgagatcatcgccaacgaccagggtaaccgcacaacaccctcgttcgtt
gccttcaccgacaccgagcgtctcattggtgactcggcaaagaaccaggtcgccatgaac
cctaccaacaccgtcttcgatgccaagcgcctcattggtcgcaagttcgccgatgctgag
gtccaggccgacatgaagcacttccccttcaaggtcattgacaaggctggcaagcctgtc
atccaggtcgagttcaagggcgaggagaagacattcacaccagaggagatctcatctatg
gtcctgactaagatgagggagactgcagagtcctacctcggtggaaccgtcaacaacgct
gtcgtcactgtcccagcctacttcaacgactcacaacgtcaggccactaaggatgctggt
ctcatcgccggcctcaatgtcctccgtatcatcaacgagcctaccgccgctgccatcgcc
tacggtctcgacaagaagacccagggtgagcgcaatgtcctcatcttcgacttgggtggt
ggtactttcgatgtttctctcttgaccattgaagagggtatcttcgaggtcaagtccact
gcaggtgacactcacttgggtggtgaagacttcgataaccgtcttgtaaaccacttcaca
caagaattcaaaagaaaacacaagaaagatctcaccaccaacgctcgtgcccttcgccgt
ctccgaaccgcttgcgaacgtgccaagcgcactctttcctcttcagctcagacctccatc
gagattgactccctctatgaaggtatcgacttctacacctccatcacccgtgcccgcttt
gaggagctgtgccaggacctcttccgctccaccatggagcctgtcgagcgtgtcctccgc
gatgccaagatcgacaagtcctctgtccacgagatcgtcctcgtcggtggatccacccgt
atccccaaggtccagaagatggtctccgacttcttcaacggaaaggagcccaacaagtcc
atcaaccccgatgaggctgtcgcctacggtgctgctgtccaggctgccatcctgtccggt
gacacatcttccaagtccacctccgagatcctgctcctcgatgtcgcgccgctgtccatc
ggtattgagaccgctggtggtgtcatgactcctctcatcaagcgcaacaccaccatcccc
accaagaagtccgaggtcttctccaccttcagcgacaaccagcctggtgtgctcatccag
gtctacgagggtgagcgtgctcgcaccaaggacaacaacttgctcggcaagttcgagctg
accggcatcccacctgctcctcgtggtgttcctcagatcgaggtcaccttcgacgtcgac
gccaacggtatcatcaacgtctccgccctcgagaagggtaccggaaagaccaacaagatc
gtcatcaccaacgacaagggccgtctctccaaggaggagattgagcgcatgttggctgag
gctgagaagtacaaggctgaggatgaggctgaggctgcccgtatcgccgccaagaacgct
ctcgagtcctacgcctactctctgcgcaacaccctcagcgactccaaggtcgacgagaag
ctcgatgctggtgacaaggagaagctcaaggccgagatcgacaagaccgtcgcctggttg
gacgacaaccagaccgccaccaaggacgagtacgagtctcagcagaaggaactcgagggt
gtcgccaaccccatcatgatgaagttctacggagctggtggtgagggtggcatgcctggc
ggtatgcccggcggcgctcctggcggtgctcccggcggcgctggcggcgatgacggccca
actgtcgaggaggttgactaa

DBGET integrated database retrieval system