KEGG   Bipolaris oryzae: COCMIDRAFT_36528Help
Entry
COCMIDRAFT_36528  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bor  Bipolaris oryzae
Pathway
bor00040  Pentose and glucuronate interconversions
bor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    COCMIDRAFT_36528
Enzymes [BR:bor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     COCMIDRAFT_36528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N Methyltransf_16 ADH_zinc_N Glu_dehyd_C Methyltransf_23 ADH_zinc_N_2 PrmA AlaDh_PNT_C UDPG_MGDP_dh_N Pyr_redox_2 AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 19123053
NCBI-ProteinID: XP_007687674
JGI: Cocmi1_36528
UniProt: W6Z248
Position
Unknown
AA seq 694 aa AA seqDB search
MSMLHVLDLPQIYTRPSAEALLDTLKLLTTAPPSWEEPGESRRKDGQAPAVTVSPEGVTG
YLTSIIGSDLRWIEDEELKEQIWDQASARLSERSGRSAMGAMSRSFHIPTSSDAFDLSIH
EPTMTGDDLGLKTWAASYLLAKRLSSFDLVPTDTQSRLQVLELGSGTGLVGLAMAGLGAD
VVLTDLPSICPNLKYNILQNDEVVNGNNGSARAAMLDWTEPQVCEPLQDDGEAMPAKFPV
ILAADSLYSVDHPRMLVDTIAVWLSQDSDAKVIVEFPYRDAYLPQIEDFRRRMVEIGLQI
VDEGEEKGYDDWGASRGSGDPDDGALVTCWWACWTRKGSSGKKPPNPSFVLQEPFKVTYE
DRPIPELPSPYDVIVRPRWTGICGSDVHYWVEGRIGHFVVEKPMVLGHESAGIVHKVGDK
VKGLKVGDEVAMEPGVPCRRCVRCKEGKYNLCPDMAFAATPPYDGTLARYYTLPEDYCYK
LPENMSMEEGALIEPTAVAVHITRQAAIKPGDSVVVFGAGPVGLLCCAVAKAYGAKKIVT
VDINDERLGFALNYAANSSFKSERVSAEENAKNMIKQCELGPGADVIIDASGAEPCIQTA
IHALRMGGTYVQGGMGKPDITFPIVAMCTKELNVKGSFRYGPGDYQTAIDLVASGRISVK
ELITGKVKFEEAENAFKEVKGGKGIKILIEGPAE
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgctacatgttctcgacctccctcaaatctatactaggccctctgctgaggcc
cttctcgataccctcaaacttcttacaactgccccaccgtcatgggaggagcctggagaa
tcgaggcgcaaagatgggcaagcgccggcagtcacagtcagtccagaaggtgtcacaggg
tacctcacgagcatcattggcagtgatctacggtggatagaggatgaagaattgaaggag
cagatctgggaccaagccagcgcgaggcttagtgaacgctctggacggtctgccatgggt
gcaatgtcacggtcatttcacattcccacttcgtccgacgctttcgacctcagcatccac
gagccgactatgactggcgacgacctgggtctgaaaacatgggcagcgtcatatctcctc
gcgaaacgcctcagctcgttcgatctggttcccacggatacacaaagtagactacaagtc
cttgaacttggttcgggaactgggctggttggactggccatggcaggcctgggtgcagac
gtcgtgctgacagacctgcccagcatctgtccaaaccttaagtacaacatacttcagaat
gacgaggtggtcaacgggaacaatggaagtgctcgcgcggccatgcttgattggactgag
cctcaggtctgcgagccactacaggacgacggtgaggccatgcccgcgaagtttccagta
atcctggctgcagattcgctgtactctgtagatcatcctcgcatgctggtagacacgatt
gcggtttggctttcgcaggacagcgacgccaaagtcattgtggagtttccctacagagat
gcatatctgcctcagattgaggactttcgccgccggatggttgagattgggctgcagata
gtggacgaaggtgaagagaaaggatacgacgactggggcgcgtccagagggagcggtgac
ccagacgacggtgcgctcgtgacgtgttggtgggcatgttggacgaggaaaggctcaagt
ggtaaaaagccaccaaacccctctttcgttctccaagaaccattcaaagtcacatatgaa
gatcggccaattcctgaactcccatcaccatacgatgtcattgtgcggccgcgatggact
ggtatctgcggttccgacgtgcactactgggtcgagggacgcatcggccactttgtagtt
gagaagcccatggtgctcggccacgagtctgccggtatcgtacacaaggttggcgacaag
gtcaagggtcttaaagtcggagatgaagtcgccatggagcctggtgtgccctgccgtcgt
tgcgtgcgctgcaaagagggaaagtacaacctctgcccagacatggcattcgcagcaact
cccccatacgacggtactctcgcacggtactatactcttcccgaggactactgctataag
ctgcccgaaaacatgagcatggaggagggcgcgttgatcgagcccaccgccgtcgctgtc
cacattacccgccaagcagccatcaagcccggcgactctgtcgtcgtattcggagctggt
cccgtcggtctgctctgctgcgccgtcgcaaaggcatacggcgcaaagaagatcgtcacc
gtcgacatcaacgacgagcgtctgggctttgcgctcaactacgcagccaactccagtttc
aagagcgagcgtgtaagcgcagaggagaacgccaaaaacatgatcaagcagtgcgaattg
ggacctggtgccgatgtcatcatcgatgcatctggcgcggagccttgcattcagactgcc
attcacgctttgcgtatgggaggaacatatgttcagggcggtatgggcaagccagatatc
accttccccattgtagcgatgtgcacaaaggaactcaacgtcaagggctccttccgctat
ggtcctggcgactatcagactgcgattgaccttgtggcaagcggccgtatctcagtcaag
gagctcatcacgggcaaagtcaagtttgaggaggctgagaatgcgttcaaggaagtcaag
ggcggcaagggcatcaagattttgatcgagggacctgctgagtag

DBGET integrated database retrieval system