KEGG   Bipolaris oryzae: COCMIDRAFT_37533
Entry
COCMIDRAFT_37533  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
bor  Bipolaris oryzae
Pathway
bor00910  Nitrogen metabolism
bor01100  Metabolic pathways
Module
bor_M00531  Assimilatory nitrate reduction, nitrate => ammonia
bor_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    COCMIDRAFT_37533
Enzymes [BR:bor01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     COCMIDRAFT_37533
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Rieske Pyr_redox Fer2_BFD Rieske_2 NIR_SIR_ferr Rubredoxin_C GIDA K_oxygenase
Other DBs
NCBI-GeneID: 19123267
NCBI-ProteinID: XP_007688833
JGI: Cocmi1_37533
UniProt: W6Z3U1
Position
Unknown
AA seq 1157 aa
MAETEPIITQGIEPSSGESHSPPGDRHITATWGSKDGNISNRQWNDPEANKLPEKVADLE
KKGEINNDRPRKRIVVVGLGMVSIAFIEKLMKYDVKRREYDVVVIGEEPHLAYNRVGLTS
FFQHRQVENLYLNPQEWYSSMPEGALSYHLNTLVTEINSEEKTVKISSGETVSYDILVLA
TGSDALLPRHTPGHDAQGVFVYRTIEDLQRLIEFSSSRKGTTGAVVGGGLLGLEAAHAMM
DLEDFAKVKLIERNRWVLSRQLDGDAGGMVVEQVRALGLDVMLSKRVGKILTTEDNFVRG
VVFEDGEEMECSCICFAIGIKARDELARKAGIKCADRGGGIVVGPDLATSQRDIYAIGEC
ASWENQTFGLIAPGVEMADVLAFNLTQAKAHAPRKFKAPDLSTKLKLLGVEVASFGDFFA
DRDGPKNLPGRQRADSKELNAKTTRDKVKNLTDGPAPPPVKALTYKDPFQQVYKKYLFTM
DGKYLLGGMMIGDTKDYIKLVPMVKNQKPLEIPPSELIVGTQKDEDDGSDLSDDTQICSC
HNVTKGDVVNATKDGTCKSIGDVKSCTKAGTGCGGCMPLVQTIFNKTMASMGNEIKNHLC
PHFEYSRADLFNIIYVKGLKDFAAVMKEAGKDANSLGCEACKPTIGSIISSLYNKHLLEV
NNRGLQDTNDRFLANIQRNGTFSVVPRVSGGEITPEKLIIIGTVAKKYNLYTKITGGQRI
DMFGARKQDLPDIWQELVDGGMESGHAYAKSLRTVKSCVGTTWCRFGIGDSVGMAVRLEE
RYKSIRGPHKFKGGVSGCVRECAEAQNKDFGLIATEKGFNIFVGGNGGAKPRHSELLAKD
VPPDDVVPILDRYLAFYIRTADKLQRTARWMENLPGGIKYLQEVILQDKLGICADLEKQM
EDLVGTFFCEWTEVLKDPKKRAWFSQFANTSETIIDTIEPTQERGQERPSYWPKDSVTED
FRGTKWTELSWQPLVKASEFQDADTGDSKAIKRGDTQLAVFKVRGKYYCTQQMCPHKRAF
VLSDGLIGDDLANNKLWVSCPYHKRNYELSGENAGKCANDESVNIAVFPIEEREDGWLYV
KLPSVEELDSVFGTSKFKIKKSETEDPFVALDKKLQRLQLKGRKGVPVSHLEEGLGEKGK
AAQILAGGERGAGGLDW
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcggaaacggaaccaatcatcacacaaggcattgagccttcatctggagaatcacac
tccccgccaggcgaccgccacatcacagcgacctggggatcaaaagatggaaatatttca
aatcggcaatggaacgatccggaagcaaataagctacctgaaaaggtagcggatctggag
aagaagggtgagatcaacaatgatcgcccacggaaaagaattgtggttgtaggattgggc
atggttagcattgcttttatcgagaaactcatgaagtacgacgttaagcggagagaatac
gacgtcgttgtcattggcgaagagccgcatcttgcatacaaccgagttggcctaacgagc
tttttccaacatcgccaagtggaaaacttgtatctcaatccgcaagaatggtattcctcc
atgccagaaggcgcattgagttaccacctcaatacacttgtcaccgagattaattctgag
gaaaagacggtcaagatatcatctggggagaccgtctcatacgacatcctagtgctggca
acaggctccgatgcgcttcttccccgacacacccccggacatgatgcacagggtgtattc
gtataccgtaccattgaggatttgcaaagattaatcgaattttcatcttcacgaaaaggc
acgactggcgctgtcgtaggcggcggcctactgggtctcgaagccgcacatgcgatgatg
gatcttgaagactttgccaaagtcaagctaattgaaagaaaccgctgggtgctgtcaagg
caattagacggcgatgccggtggtatggttgtggagcaagtacgagcattgggcttggac
gtaatgctaagcaagagggtgggcaagattttaactaccgaggacaactttgttaggggc
gtggtgtttgaggacggcgaagagatggagtgttcttgtatttgcttcgcgattggtatc
aaagctcgagatgagctggctagaaaagccggcatcaaatgtgctgacagaggaggcggc
atagtcgtcggacccgatctagcaacatcccaacgcgacatctacgccattggcgagtgt
gcgagctgggagaaccaaacctttggcctcatcgctcctggtgtcgagatggccgacgta
ctagctttcaacttgacccaagcgaaagcacatgcgccgcgaaagttcaaggccccagat
cttagcacaaagctcaagttgctaggtgtcgaagttgcgagtttcggtgacttctttgcc
gaccgcgatggacccaagaatctgcctggacgccagcgcgccgatagcaaggagctgaat
gcaaagacgacacgagacaaggttaagaatctgacagatggaccggcaccaccaccggtc
aaggcgctcacgtacaaagacccattccagcaggtctacaagaagtatctattcaccatg
gacggaaagtatctgttgggtggcatgatgattggcgatacgaaagactacatcaagctt
gtacctatggtgaaaaaccagaagccgcttgagataccccccagcgaactgattgtcggc
acacaaaaggatgaagatgatggttctgatctatccgatgatacccagatctgttcatgc
cacaacgtcaccaaaggtgatgtagtcaatgccaccaaagatggaacttgcaagagcatc
ggcgacgtcaagtcttgcaccaaagccggcactggctgcggtggctgcatgcccctcgtc
caaaccattttcaacaagaccatggcttctatgggcaacgagatcaaaaaccatctttgc
ccacattttgagtactcacgcgccgatctcttcaacatcatttacgttaagggtctcaag
gatttcgccgctgtgatgaaggaggcaggaaaggacgccaactctctgggatgtgaggcc
tgcaaaccgaccattggaagcatcatctcttcgctgtacaacaaacatctgcttgaggtg
aacaaccgaggtctccaagatacaaacgatcgattcctggccaacatccaacgcaacggc
acattttccgttgttccacgggtttctggtggcgagatcacaccggagaagctcatcatc
attggaacagtggcgaagaagtacaacctctacactaaaattacgggcggccagcgcatc
gacatgtttggtgcgcgcaaacaagacctcccagatatctggcaagagcttgtcgatggc
ggcatggagtctggccatgcgtatgcaaagtcgctccgaactgtcaagtcatgtgttgga
actacatggtgccgcttcggcattggtgatagtgtaggcatggctgtgcgtctagaagag
cgctacaagtccattcgtggtccacacaagtttaagggcggagtttcaggctgtgtgcgc
gaatgcgcagaggctcagaacaaggactttggtctcattgctaccgaaaagggattcaat
atctttgttggtggcaacggtggtgcaaagcccaggcattcggaactactagccaaagac
gtgccaccagatgacgtggtccctatcctcgatcgctatctcgcattctacatccggact
gccgacaagctgcaaagaacggcccggtggatggagaacctcccaggcggtatcaagtac
ctccaggaagtcatcctgcaagacaaactcggcatctgcgccgatctagagaagcaaatg
gaagatctcgtgggcactttcttctgcgaatggaccgaagtcctcaaagaccccaagaaa
cgcgcttggttctcccaattcgcaaacacatcggagaccatcatcgacactatcgagccc
acacaagaacgcggccaagaacgcccttcctactggcccaaagactccgtcactgaagac
ttccgcggcacaaaatggacagaactctcctggcaacccttggtcaaagcctcagagttc
caagacgcagatactggcgatagtaaggccatcaaacgtggcgacacgcaactcgccgtc
ttcaaagtccgcggcaaatactactgcacgcaacaaatgtgcccgcacaagcgtgctttc
gtgctctccgacggcctcattggcgacgacctcgcaaacaacaaactctgggtctcgtgt
ccctaccacaaacgcaactacgagctgtcgggcgaaaacgcaggcaaatgtgcaaacgac
gagtccgtcaacattgctgtattcccgattgaagagcgggaggatggctggttgtatgtt
aagctgccgagtgtggaggagctggatagcgtgtttgggaccagcaagtttaagattaag
aagagtgagactgaagatccgtttgtggcgctcgataagaagttgcagaggttgcagctt
aaaggcaggaagggcgtgccagtttcgcatcttgaggagggactgggggagaaagggaag
gcggcgcagatactagctggcggggagaggggtgctggggggttggattggtaa

DBGET integrated database retrieval system