KEGG   Bipolaris oryzae: COCMIDRAFT_80393Help
Entry
COCMIDRAFT_80393  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
bor  Bipolaris oryzae
Pathway
bor00350  Tyrosine metabolism
bor00360  Phenylalanine metabolism
bor00380  Tryptophan metabolism
bor01100  Metabolic pathways
bor01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    COCMIDRAFT_80393
   00360 Phenylalanine metabolism
    COCMIDRAFT_80393
   00380 Tryptophan metabolism
    COCMIDRAFT_80393
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    COCMIDRAFT_80393
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bor04147]
    COCMIDRAFT_80393
Enzymes [BR:bor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     COCMIDRAFT_80393
    4.1.1.105  L-tryptophan decarboxylase
     COCMIDRAFT_80393
Exosome [BR:bor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCMIDRAFT_80393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 19125661
NCBI-ProteinID: XP_007682424
JGI: Cocmi1_80393
UniProt: W6ZLY1
Position
Unknown
AA seq 519 aa AA seqDB search
MDSSQFRKAAKGAIDEIAQYYDTLEERPVLPAVKPGYLRPLLPSSTPEEGEPWEAIQADI
DRVIMPGLTHWQSPKFMAFFPCNSSFEGMLGEMYSGAFNAAAFNWVCSPAITELETVVMD
WVAKLIALPSDFLSDGEGGGIIQGTASEVVLTALVAARERIIRRKLGDMPEGEERLDAAA
DIRSKLVALGSEHAHSSTQKAAVIAGTRFRTVPAPKESNYSVTAAALRSTIEACRAKGLE
PFYFTITLGSTGTCAIDDLAGIAQLAKEYPDLWIHVDAAYAGSALVCPEYQHLCPPIASF
DSFNFNLHKWLLVNFDCSAFFIKKRGDLMDTYSITPSYLRNPHSDQGLVTDYRDWQIPLG
RRFRSLKVWFVLRSYGVSGLRAFIRKHVELGVYFQSLLEGRKDLFRVETEAAFGLVTFQI
KPTTAGSEDASAANQPDPRHGALQNAFQGDAEAQYAEMVNQRTKEVYERVNSKGDFFLTS
TVIGGRYVIRVVSATIKSEENWMKMLFEELVEIAEGKAA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggattcttcacagttccgaaaggcggcgaaaggagccattgacgaaattgcacaatac
tatgacacattagaggaacgaccagttctgcccgctgtcaagccaggctatctccgccct
ctcctcccatcctcaaccccagaagaaggcgagccatgggaagccatccaagcagacatc
gaccgcgtaatcatgcccggcctcacgcactggcagtcccccaagttcatggccttcttc
ccctgcaactcctccttcgaaggcatgctgggtgaaatgtacagcggagcctttaacgcc
gcagccttcaactgggtctgctcacccgccatcaccgagctcgaaaccgtcgtcatggac
tgggtcgctaagctcatcgccctacccagcgacttcctcagcgacggcgaaggcggcggc
atcatccaaggcaccgccagcgaagtcgttctaaccgccctcgtcgccgcccgcgaacgc
atcatccgccgcaaactcggcgacatgcccgaaggcgaagaaagactcgacgctgcagca
gacatccgcagcaaactcgtagccctcggctccgaacacgcgcattcttcaacccaaaaa
gcagcagtgattgcaggaacccggttccgcaccgttcccgcaccaaaagaatcaaattac
agtgtcacggccgccgccctccgcagcacaatcgaagcctgtcgcgcgaaaggtctcgag
ccgttctacttcaccatcaccctcggcagcacaggtacctgcgccattgacgatctcgcc
ggcattgcgcagctcgcaaaggagtaccccgatctctggatccacgtcgacgccgcatac
gccggttccgcgctcgtctgtcctgaataccaacatctctgtcccccaatcgcatcgttt
gactcgttcaacttcaatctgcacaaatggctcttagtgaactttgactgctctgcgttc
tttattaagaagaggggggatctcatggatacgtactccatcaccccgagttacctgcgg
aatccacactcggatcagggtcttgtcaccgattatcgcgactggcagattccgctcggt
cgccggtttcgtagcttgaaggtgtggtttgtgctccggagctacggggtctcgggtctg
agggcgttcatccgcaagcatgttgagttgggtgtgtatttccagagtttactcgaggga
cgcaaggatcttttcagggtggagaccgaggcggcgtttgggctggtgacgttccagatc
aagccgacgacggcggggagtgaagatgcgagtgcggcgaatcagccggatccgaggcat
ggggcgctgcagaatgcgttccagggggatgctgaggcgcagtatgctgagatggtgaat
cagcggacaaaggaggtgtatgagagggtgaatagtaagggggatttcttcttgacgagt
acggtgattggggggaggtatgtgattcgggttgttagtgcgacgatcaagagtgaggag
aattggatgaagatgttgtttgaggagttggtggagattgcagaagggaaggcggcgtga

DBGET integrated database retrieval system