KEGG   Bipolaris oryzae: COCMIDRAFT_98732Help
Entry
COCMIDRAFT_98732  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bor  Bipolaris oryzae
Pathway
bor00260  Glycine, serine and threonine metabolism
bor01100  Metabolic pathways
bor01110  Biosynthesis of secondary metabolites
bor01130  Biosynthesis of antibiotics
bor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COCMIDRAFT_98732
Enzymes [BR:bor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     COCMIDRAFT_98732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 19129320
NCBI-ProteinID: XP_007689246
JGI: Cocmi1_98732
UniProt: W6Z9Q3
Position
Unknown
AA seq 441 aa AA seqDB search
MPRTLLYPLQRLLRTSLTVNTRTVAASIVRPANPTLRSLHTTARLTMGEFDQYSAMSSKT
VPNGIPSDGTAWGSEKNPAAFDLRSDVHTTPTMSMLRAIQQCTLLDDVFMEDPTTLSLER
FIADLSGKEDGLLVLSGTMGNQVAFRAHLTCPPHAVIVDRRGHIVNYEAGGVATLSQAMV
QSLDATNGTYLTLEDIQKYATLSDDVHSCPTRMISLENTLNGAIMPLSEVKRISAWARQH
GIIMHLDGARLWEAVAAGAGSLKDFCAEFDSISLCISKGLGAPIGSLLVGTKAFIKRSRW
IRKSIGGGLRQAGVVAAPMRVAIEETFLGGKLAQSHKNAKRVAKIWTDLGGKLQYPVDTN
MVWLDLAAHDIERNSFIELAEKYGVRTGSGRLVIHYQIGEEAIEALQKVFTELLTGKESA
GKLAEAPHDPEDLKLKGKGVE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggacacttttatacccgctacagcgccttctcagaacaagcttgactgtgaat
actcgaaccgtcgccgcatccattgtccgccccgcgaaccccaccctgcgcagcctgcat
acaacagcacggctcaccatgggcgaattcgaccagtactctgctatgagcagcaagact
gtacccaatggcataccctccgatggcacggcctggggtagtgaaaagaacccggccgcc
tttgacctgcgttcggatgtgcacacaacccctaccatgtccatgctcagggctattcag
caatgcaccctactcgacgatgtcttcatggaggaccctactacactctctcttgagcgc
ttcattgcagacttgagcggaaaagaagacgggcttctcgttctctcgggtaccatgggc
aaccaggttgcattccgggcacaccttacctgtcctccacatgccgtgattgtcgaccgg
cgagggcacattgtcaattacgaggcaggaggtgtagctaccttgtctcaagccatggtc
cagtctctcgacgcgacaaacggcacatacctcactttggaagatattcaaaagtatgcg
acactctcagatgacgtgcactcttgcccaacgcgcatgatttcccttgaaaatacactg
aatggtgccatcatgcctctttccgaagtcaagcggatatctgcttgggcacgccaacat
ggtatcatcatgcatctggacggtgcgcgcttgtgggaggctgttgctgcaggcgccggt
tccctaaaggatttttgtgccgaattcgacagcatcagtctgtgcatcagcaagggccta
ggtgcgcccattggaagtctccttgttggcacaaaagctttcattaaacgtagtcgctgg
atccgcaagtccattggcggaggactgcgccaggctggtgtggtcgctgctccgatgcgc
gtcgccattgaagagacgttccttggcgggaaacttgcacaatctcacaagaacgcgaag
agggttgcgaagatatggaccgacctaggaggcaagctacaatacccggtagacacaaac
atggtttggttggacctggcggcccacgatattgaacgcaacagcttcatcgagctagct
gaaaagtatggagtaagaacgggtagtggtagactggttatacattaccagattggagaa
gaggcgattgaagcgttgcaaaaggtctttactgagttgttgacgggcaaagagtcggcc
ggcaaacttgccgaagcgccgcatgacccggaggatttgaagctgaagggcaaaggcgtg
gagtag

DBGET integrated database retrieval system