KEGG   Bosea sp. RAC05: BSY19_1319Help
Entry
BSY19_1319        CDS       T04462                                 

Definition
(GenBank) DNA ligase, ATP-dependent, family
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bos  Bosea sp. RAC05
Pathway
bos03030  DNA replication
bos03410  Base excision repair
bos03420  Nucleotide excision repair
bos03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bos00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BSY19_1319
   03410 Base excision repair
    BSY19_1319
   03420 Nucleotide excision repair
    BSY19_1319
   03430 Mismatch repair
    BSY19_1319
Enzymes [BR:bos01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BSY19_1319
    6.5.1.6  DNA ligase (ATP or NAD+)
     BSY19_1319
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BSY19_1319
DNA replication proteins [BR:bos03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BSY19_1319
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BSY19_1319
DNA repair and recombination proteins [BR:bos03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BSY19_1319
   NER (nucleotide excision repair)
    Other NER factors
     BSY19_1319
   MMR (mismatch exicision repair)
    Other MMR factors
     BSY19_1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: AOG07096
UniProt: A0A1B3NP07
Position
1403010..1404647
Genome map
AA seq 545 aa AA seqDB search
MNRFAWLLDRLAYEPRRNAKLALIADYLRSTPDPDRGLALAAMTGGLVFPNAKAGLVRAL
IAERTDPVLFALSYDYVGDLSETVALMWPARRGANDVPHLPDVVEGLRSVGKTELPRLVA
SWLDALDETGRWALLKLITGSLRIGVSARLAKTAAASLGGIPADEVEQVWHGLEPPYATL
FAWLEGRGPRPEATDPAPFRPVMLSHPIEDGDFEKMNPAEFQAEWKWDGIRVQAVTGTRP
DGERVTRLFSRTGEDIAAAFPDVVEALTLDGTLDGELLVRREAAVQSFNSLQQRLNRKSV
TSKMLLEHPAHIRAYDLLVDGEDDLRELPLSARRTRLEAFVARLASPVVDLSPPIAFSDW
ESLAAARADPAAAGAGADAEAVEGCMIKRLDSPYLPGRPKGHWWKWKREARLVDCVLMYA
QRGHGKRSSFYSDFTFGVWRAGEGGADELVPVGKAYFGFTDEELVELDRYVRKHTLNRFG
PVREVTHTRDSGLVFEVAFEGLQRSTRHKSGVAMRFPRISRIRWDKPPLEADRIEALEAL
LPPNG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgtttcgcctggctcctcgaccggctggcctatgagccgcgccgcaatgccaag
ctcgcgctgatcgcggattacctgcgcagcacgcccgatcccgaccgcggtctcgccctg
gcggcgatgacgggcgggctcgtctttcccaacgccaaggccgggctcgtccgggcgctg
atcgccgagcggacggacccggtgctgtttgcactctcctacgactatgtcggcgatctc
tcggagacggtggcgctgatgtggccggcgcgtcggggggcgaacgacgtgccccatttg
ccggacgtcgtcgagggcctgcgtagcgtcggcaagaccgagttgccgcgcctcgtcgcc
tcctggctcgacgcgctcgacgagaccggccgctgggcgctgctgaagctgatcaccggc
tcgctgcgcatcggcgtctccgcgcgcctcgcgaagacggcggccgccagcctcggcggc
atcccggccgacgaggtcgagcaggtctggcacgggctggagccgccctatgccacgctc
ttcgcctggctggagggcaggggcccgcggcccgaggcgaccgatcctgcccccttccgg
ccggtgatgctgtcgcacccgatcgaggacggcgatttcgagaagatgaacccggccgaa
ttccaggccgagtggaaatgggacggcatccgcgtccaggccgtcaccggtacgcggccc
gatggcgagcgcgtcacgcgtttgttctcgcggaccggcgaggacatcgcggccgccttc
ccggacgtggtcgaggcgctgacgctggatggcacgctcgacggcgaactgctggtgcgg
cgcgaggcggcagtccagagtttcaacagcctgcagcagcggctcaaccgcaagagcgtg
acgtccaagatgctgctcgagcaccccgcgcatatccgcgcctatgacctgctcgtcgat
ggtgaggacgatctgcgcgagctgccgctctcggcgcgccggacgcggctggaggctttc
gtggcccgcctcgccagcccggtcgtcgacctctccccgccgatcgccttcagcgactgg
gagtcgctggccgccgcgcgcgccgaccctgcggctgcgggcgccggcgccgatgcggaa
gccgtcgagggctgcatgatcaagcgcctcgattcgccttatctgccgggccgccccaag
ggccattggtggaagtggaaacgcgaggccaggctcgtcgactgcgtgctgatgtatgcc
cagcgcggccacggcaagcgctcgtccttctattcggatttcaccttcggggtctggcgc
gccggtgaaggcggggcggacgagctggtgccggtcggcaaggcctatttcggcttcacc
gacgaggaactcgtcgaactcgaccgttatgtccgcaagcacacgctcaaccgcttcggt
cccgtgcgcgaggtcacgcatacgcgcgacagcgggctcgtcttcgaggtcgccttcgag
gggctgcagcgctcgacgcggcacaagtccggcgtcgccatgcgctttccccgcatcagc
cggattcgctgggacaagcccccgctcgaggccgaccggatcgaggcgctggaggcgctg
ctgccgccgaatggctga

DBGET integrated database retrieval system