KEGG   Bosea sp. RAC05: BSY19_2117Help
Entry
BSY19_2117        CDS       T04462                                 

Definition
(GenBank) mandelate racemase/muconate lactonizing enzyme
  KO
K20023  L-talarate/galactarate dehydratase [EC:4.2.1.156 4.2.1.42]
Organism
bos  Bosea sp. RAC05
Pathway
bos00053  Ascorbate and aldarate metabolism
bos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BSY19_2117
Enzymes [BR:bos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.42  galactarate dehydratase
     BSY19_2117
    4.2.1.156  L-talarate dehydratase
     BSY19_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AOG08045
UniProt: A0A1B3NRQ4
Position
2240427..2241545
Genome map
AA seq 372 aa AA seqDB search
MRIARIEPFILHIPVTGGSIADSTHRISHWGVVGTKIVTEEGLEGYGFTGTHADLPSDRL
ITACIRDCYAPLLVGEDASESNRLWLKLARHPALQWVGRAGITQLALAAVDVALWDLKAK
KAGVPLWHLLGGASKPRLEAYNTDIGWLSIPKDQLIEGCRRAVEQDGFHRIKVKVGHADP
GIDIGRLEAVRRAVGPHVSLAIDGNGKWDLPTCKRFCARAEPLDIFWFEEPLWYDDVGSH
AALARDTSIPVALGEQLYSLDAFRAFIAADAIHYVQPDVTRLGGITEYIQVADLALASRL
PVAPHAGEMSQVHVHLAYWHQATPVLEYIPWIKDAFEEPANVVDGCFLKPQRPGAGTTPT
NDAFARFAKPLG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgccagaatcgaacccttcatcctgcatatccccgtcaccggcgggtcgatc
gccgattcgacgcatcggatcagccattggggcgtcgtcggcaccaagatcgtcacggag
gaggggctggagggctatggtttcaccggcacccatgccgatctgccctccgaccggctg
atcaccgcctgcatccgcgattgctacgccccgctgctggtcggcgaggatgcctcggag
agcaaccggctctggctcaagctcgcccggcacccggccctgcaatgggtcggtcgcgcc
ggcatcacccagctcgcgctcgctgcggtggatgtcgcgctctgggatctcaaggcgaag
aaggccggcgtgccgctctggcacctgctcggtggcgccagcaagccgaggctcgaggcc
tacaacaccgatatcggctggctctcgatcccgaaggaccaactgatcgagggctgccgg
agggccgtcgagcaggacggctttcaccgcatcaaggtcaaggtcggccatgccgatccc
ggcatcgacatcggccggctcgaggcggtgcggcgggcggtcggcccgcatgtttcgctc
gccatcgacggcaacggcaaatgggatctgccgacctgcaagcgcttctgcgcccgggcc
gagccgctcgacatcttctggttcgaggagccgctctggtatgacgatgtcggctcgcat
gccgcgctcgcccgcgacacgtcgatccccgtcgcactcggcgagcagctctattcgctg
gacgccttccgcgccttcatcgcggcggatgcgatccactatgtccagcccgatgtgacc
cggctcggcggcatcaccgaatacatccaggtcgccgatctcgctctggcgagccgcctg
ccggttgcgccccatgccggcgagatgagccaggtccatgtccatctcgcctattggcac
caggcgacgccggtcctcgaatacatcccctggatcaaggacgccttcgaggagccggcc
aacgtcgtcgatggctgcttcctgaaaccccagcggccgggcgccggcacgacaccgacg
aacgacgccttcgctcgcttcgccaagccgctgggctga

DBGET integrated database retrieval system