KEGG   Bosea sp. RAC05: BSY19_363Help
Entry
BSY19_363         CDS       T04462                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
bos  Bosea sp. RAC05
Brite
KEGG Orthology (KO) [BR:bos00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BSY19_363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AOG05278
UniProt: A0A1B3NIV0
Position
complement(392266..392658)
Genome map
AA seq 130 aa AA seqDB search
MYQAETQGVRVTAVPSFMEGESSPAQGRYFWAYTIEILNLSVRTVQLMSRHWFITDGRGE
VHEVRGEGVVGQQPVLRPGESYSYTSGCPLMTPDGSMRGFYAMLAEDGTIFDVAVPLFPL
DSPYVKKVLH
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaggctgagacgcagggcgtgcgggtgaccgccgtgccgagcttcatggagggt
gaatcctctccggcgcagggccgctatttctgggcctataccatcgagatcctcaatctc
tcggtgcggacggtgcagctgatgagccggcactggttcatcaccgacgggcgcggcgag
gtccatgaggtccgcggcgaaggcgtcgtcgggcagcagccggtgctgcggccgggcgag
agctacagctacacctccggctgtccgctgatgaccccggacggctcgatgcgcggcttc
tatgccatgctggcggaggacggcacgatcttcgatgtcgcggtgccgctgtttccgctc
gattccccttatgtgaagaaggtcctgcattga

DBGET integrated database retrieval system