KEGG   Bosea sp. RAC05: BSY19_4463Help
Entry
BSY19_4463        CDS       T04462                                 

Definition
(GenBank) 3-Oxoacyl-[acyl-carrier-(ACP)] synthase III family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bos  Bosea sp. RAC05
Pathway
bos00071  Fatty acid degradation
bos00072  Synthesis and degradation of ketone bodies
bos00280  Valine, leucine and isoleucine degradation
bos00310  Lysine degradation
bos00362  Benzoate degradation
bos00380  Tryptophan metabolism
bos00620  Pyruvate metabolism
bos00630  Glyoxylate and dicarboxylate metabolism
bos00640  Propanoate metabolism
bos00650  Butanoate metabolism
bos00900  Terpenoid backbone biosynthesis
bos01100  Metabolic pathways
bos01110  Biosynthesis of secondary metabolites
bos01120  Microbial metabolism in diverse environments
bos01130  Biosynthesis of antibiotics
bos01200  Carbon metabolism
bos01212  Fatty acid metabolism
bos02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bos00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY19_4463
   00630 Glyoxylate and dicarboxylate metabolism
    BSY19_4463
   00640 Propanoate metabolism
    BSY19_4463
   00650 Butanoate metabolism
    BSY19_4463
  Lipid metabolism
   00071 Fatty acid degradation
    BSY19_4463
   00072 Synthesis and degradation of ketone bodies
    BSY19_4463
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSY19_4463
   00310 Lysine degradation
    BSY19_4463
   00380 Tryptophan metabolism
    BSY19_4463
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSY19_4463
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSY19_4463
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSY19_4463
Enzymes [BR:bos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSY19_4463
Exosome [BR:bos04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSY19_4463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: AOG07380
UniProt: A0A1B3NPV2
Position
4681387..4682556
Genome map
AA seq 389 aa AA seqDB search
MSAAIVGWAHTPFGKQDAETIESLIVRVTTDALIDAGITADQVDEIVLGHFNAGFSAQDF
TASLVLQADPALRFKPATRVENACATGSAAVQQGVRAIKAGAAKIVLVVGVEQMTTTPGP
EIGKNLLKASYLPEEGATQGGFAGVFGGIAAAYFQRHGDQSDALAMIAAKNHKNGVDNPY
AQMRKDLGFAFCREESEKNPYVAGPLKRTDCSLVSDGAAALVLADEETALTMRRAVGFRG
TAHVQDFLPVSKRDILRFEGATRAWQQALAQAGVTLDDLSFVETHDCFTIAELLEYEAMG
LTREGDGARAIKEGWTQKDGKLPVNVSGGLKAKGHPIGATGVSMHVLSAMQLVGEAPEGM
QLRDARLGGIFNMGGSAVANYVSVLERIK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgcgatcgtcggttgggcccatacgccgttcggcaagcaggatgcggagacg
atcgaaagcctgatcgtgcgggtgacgaccgacgcgctgatcgatgccggcatcaccgcc
gaccaggtcgacgagatcgtgctcgggcatttcaacgccgggttctcggcgcaggacttc
accgcctcgctcgtccttcaggccgatcccgccctgcgcttcaagccggcgacccgggtc
gagaacgcctgcgccaccggctcggccgccgtgcagcagggcgtgcgcgcgatcaaggcc
ggcgcggccaagatcgtgctcgtcgtcggcgtcgagcagatgaccacgacgcccggcccc
gagatcggcaagaacctgctcaaggcctcctacctccccgaggaaggggcgacccagggc
ggcttcgccggcgtgttcggtggcatcgccgccgcctatttccagcgccatggcgaccag
tccgacgcgctggcgatgatcgcggccaagaaccacaagaacggcgtcgacaacccctat
gcccagatgcgcaaggacctcggcttcgccttttgccgcgaggagagcgagaagaacccc
tatgtcgccggcccactgaagcgcaccgactgctcgctggtctccgacggcgcggccgcg
ctcgtgctggccgacgaggagaccgcgctgaccatgcgccgtgccgtcggcttccgtggc
acggcccatgtccaggatttcctgccggtctccaagcgcgacatcctgcgcttcgagggc
gcgacgcgcgcctggcagcaggcgctggcgcaggcaggcgtgacgctcgacgacctctcc
ttcgtcgagacgcatgactgcttcaccatcgccgagctgctggaatacgaggccatgggc
ctgacccgcgaaggcgacggcgcccgcgccatcaaggagggctggacgcagaaggacggc
aagctgccggtcaacgtctccggcggcctcaaggccaagggccatccgatcggtgcgacc
ggcgtctccatgcatgtgctcagcgcgatgcagctcgtcggagaggccccggagggcatg
cagctgagggatgcgcgcctcggcggcatcttcaacatgggcggttctgcggtggcgaac
tacgtctcggtgctcgagcggatcaagtga

DBGET integrated database retrieval system