KEGG   Bradyrhizobium ottawaense: CIT37_06395Help
Entry
CIT37_06395       CDS       T05524                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bot  Bradyrhizobium ottawaense
Pathway
bot00670  One carbon pool by folate
bot01100  Metabolic pathways
bot01120  Microbial metabolism in diverse environments
bot01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bot00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CIT37_06395 (metF)
Enzymes [BR:bot01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     CIT37_06395 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR SelB-wing_1
Motif
Other DBs
NCBI-ProteinID: AWL91873
UniProt: A0A2U8P2C9
Position
1356957..1357877
Genome map
AA seq 306 aa AA seqDB search
MTDLTIPARADGQDGHLKRPAISFEFFPPKTEDMERNLWETINRLAPLDPKFVSVTYGAG
GSTRERTHSTIARILKETALLPAAHLTCVGASRGEIDEIVDRYHEVGVRHIVGLRGDPAG
GIGTPYASHPDGYQSSAELVAGIKKRHADIEVSVSAYPEKHPEARDFDDDIDTLQAKVDA
GATRAITQVFFDNDLYFRYLDRVRVRGINIPIVPGIMPMHNFKQARNFVTRAGTTVPDWF
AAKFEGLDEDAETRKLVAATVAAGQVQKLAKHGVDTFHFYTMNRADLVFAISHLLGIRAK
SAQKAA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctgacgattcctgcccgagccgacgggcaagacgggcacctgaagcggcct
gcgatctccttcgagttctttccacccaagacggaagatatggagcgcaatctctgggag
accatcaaccggctcgctccgctcgacccgaaattcgtctcggtgacctacggcgccggc
ggctcgacccgcgagcgcacccattcgaccatcgcccgtatcctgaaagagaccgccctg
ctgccggcggcgcacctgacctgcgtcggtgcctcgcgcggcgagatcgacgagatcgtc
gaccgctatcacgaggtcggcgtccgccatatcgtgggcctgcgcggcgatcccgccggc
ggcatcggcacgccctatgccagccatcccgacggctatcagagctcggccgagctcgtc
gcggggatcaagaagcggcatgccgacatcgaagtgtccgtgtcggcctatcccgagaag
caccccgaagcgcgcgacttcgatgatgatatcgacacgctgcaggccaaggtcgatgcc
ggcgcgacgcgcgcgatcacccaggtgttcttcgacaacgacctctacttccgctatctc
gaccgcgtgcgggtgcgcggcatcaacattccgatcgtgccgggcatcatgcccatgcac
aatttcaagcaggcccgcaatttcgtgacgcgcgccggcaccaccgtgccggactggttc
gccgcgaaattcgaaggcctcgacgaggacgccgagacccgcaagctggtggccgcaacc
gtcgcggccggccaggtgcagaagctcgccaagcacggcgtcgacactttccatttctac
accatgaaccgcgccgatctcgtgttcgcgatcagccatctgctcggcattcgcgccaag
agcgcccagaaagcggcctga

DBGET integrated database retrieval system