KEGG   Bradyrhizobium ottawaense: CIT37_12550Help
Entry
CIT37_12550       CDS       T05524                                 

Definition
(GenBank) aminotransferase class V-fold PLP-dependent enzyme
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
bot  Bradyrhizobium ottawaense
Pathway
bot00250  Alanine, aspartate and glutamate metabolism
bot00260  Glycine, serine and threonine metabolism
bot00630  Glyoxylate and dicarboxylate metabolism
bot00680  Methane metabolism
bot01100  Metabolic pathways
bot01110  Biosynthesis of secondary metabolites
bot01120  Microbial metabolism in diverse environments
bot01130  Biosynthesis of antibiotics
bot01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CIT37_12550
  09102 Energy metabolism
   00680 Methane metabolism
    CIT37_12550
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CIT37_12550
   00260 Glycine, serine and threonine metabolism
    CIT37_12550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bot01007]
    CIT37_12550
Enzymes [BR:bot01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     CIT37_12550
    2.6.1.45  serine---glyoxylate transaminase
     CIT37_12550
    2.6.1.51  serine---pyruvate transaminase
     CIT37_12550
Amino acid related enzymes [BR:bot01007]
 Aminotransferase (transaminase)
  Class V
   CIT37_12550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AWL92953
UniProt: A0A2U8P5G2
Position
complement(2665896..2667083)
Genome map
AA seq 395 aa AA seqDB search
MTVRAGREFLAIPGPTTMPDEVLRAMHRPAIDIYSKEMLDLTESLLGDISKLFSTKGKSY
IYIANGHGAWEAALSNVLSRGDKVLVLESGRFAIGWGNAAALMGAEVEVLKGDWRRAVRP
HEVEERLRRDKEHTIKAVVVVQVDTASGVQNDIEAIGKAIKASGHPALYMVDTVASLGCM
PFEMDKWGIDVAMSGSQKGLMTPPGLGFVAANARALEVHKKANMSTPYWSWSERDGTENY
RKYAGTAPVHLLFALRKAIDMLHEEGLENAFRRHSLLGEAARRAVGAWSEGQVLGFNVAE
ASERSNTVTTVTMSNGHDPAALQRYCKDKCGVVLGTGIGDLSGQAFRIAHMGHVNAPMLL
GTLGVIEIGLNALKIPHGMGGLEAAVAYLGDEVAV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcgcgcgggccgggaatttctggccatccccgggcccaccaccatgcccgac
gaggtgctgcgggcgatgcatcgtccggcgatcgacatctactccaaggagatgctcgac
ctgaccgagagcctgctcggcgacatctcgaaactgttctcgaccaagggcaagtcctac
atctacatcgccaacggccacggcgcctgggaagcggcgctgagcaacgtgctgtcgcgc
ggcgacaaggtgctggtgctggagagtggccgtttcgcgatcggctggggcaatgcggcg
gcgctgatgggtgccgaggtcgaggtgctcaagggcgactggcgccgcgcggtgcggccg
cacgaggtcgaggagcgcctgcgccgcgacaaggagcacaccatcaaggccgtcgtcgtc
gtccaggtcgacacggcctcgggcgtgcagaacgacatcgaggcgatcggcaaggcgatc
aaggcgagcggccatccggcgctgtacatggtcgacaccgtcgcttcgctcggctgcatg
ccgttcgagatggacaaatggggcatcgatgttgcgatgtccggctcgcagaagggcctg
atgacgccccccggcctcggcttcgtcgccgccaatgcgcgcgcgctcgaggtgcacaag
aaggccaacatgtcgacgccctattggagctggagcgagcgcgatggcaccgagaattac
cgcaaatacgccggcaccgcgccggtgcatctcttgttcgctttgcgcaaggcgatcgac
atgctgcacgaggaaggcctggagaacgccttccgccgccacagcctgctcggcgaagcc
gcacgccgcgcggttggcgcatggtcggaaggccaggtgctcggctttaacgtggcggag
gccagcgagcgctccaacaccgtgaccacggtgaccatgagcaacggccatgatccggcg
gcgctgcaacgctattgcaaggacaagtgcggcgtggtgctcggcaccggcatcggcgac
ctctcgggccaggccttccgcatcgcccatatgggccatgtcaacgcgccgatgctgctc
ggcacgctcggggtgatcgagatcggcctgaacgccctgaagatcccgcacggcatgggc
ggactggaggcggcggtggcgtatctcggcgacgaggtggcggtgtag

DBGET integrated database retrieval system