KEGG   Bradyrhizobium ottawaense: CIT37_20970Help
Entry
CIT37_20970       CDS       T05524                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bot  Bradyrhizobium ottawaense
Pathway
bot00480  Glutathione metabolism
bot00590  Arachidonic acid metabolism
bot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bot00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CIT37_20970
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CIT37_20970
Enzymes [BR:bot01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CIT37_20970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AWL94360
UniProt: A0A2U8PA33
Position
4380355..4380831
Genome map
AA seq 158 aa AA seqDB search
MSAIYDFKANSLAGEEVALRRFEGQVLLIVNTASKCGFTPQYRGLEDLHRDLSPRGFSVL
GFPCNQFGAQEPGQASEIQAFCSTNYDVTFPLFEKIDVNGAHAHPLYEYLKHQQSGLLGA
SIKWNFTKFLVDRQGRVIARYAPTARPEGLRNQIETLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgatctacgatttcaaggccaactcgcttgcgggtgaggaggttgcgctccgc
cgcttcgaggggcaggtgctcctgatcgtcaacaccgcgagcaaatgcggcttcacgccg
caatatcgcggtctggaggatctgcatcgcgatctctcgccgcgcggcttctccgtgctc
ggctttccctgcaaccagttcggcgcgcaggagccggggcaggcgagcgagatccaggcg
ttctgctcgaccaattacgacgtcacctttcccttgttcgagaagatcgacgtcaacggc
gcccatgcgcaccctctgtatgagtacctgaaacaccagcaatcgggcttgttaggggcc
tccatcaaatggaatttcaccaaattcctggtggaccgtcagggccgcgtaatcgcgcgc
tacgcgccgaccgcacggcccgaaggattgcggaatcaaatcgagaccctgttatga

DBGET integrated database retrieval system