KEGG   Bradyrhizobium ottawaense: CIT37_31315Help
Entry
CIT37_31315       CDS       T05524                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bot  Bradyrhizobium ottawaense
Pathway
bot00450  Selenocompound metabolism
bot00970  Aminoacyl-tRNA biosynthesis
bot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CIT37_31315
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CIT37_31315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bot01007]
    CIT37_31315
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bot03016]
    CIT37_31315
Enzymes [BR:bot01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CIT37_31315
Amino acid related enzymes [BR:bot01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CIT37_31315
Transfer RNA biogenesis [BR:bot03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CIT37_31315
 Prokaryotic type
   Other AARSs
    CIT37_31315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AWL96125
UniProt: A0A2U8PED8
Position
6501375..6503393
Genome map
AA seq 672 aa AA seqDB search
MATRAKKTAKGKGRNKAAKKAAKKAVKARASKANAKAAKKVRKTKKATAKKGAKKSAVKT
AKKAVKKAAKKPAVAKKAVKKAAKKPANKSAKTPAKSPAKTVAKKARVVAPVIAAPAPAA
TPPKAAKPKAPRAPKPAAAPQAAAPAAAPKAAAPVAAPARDNVFYITTAIAYPNGSPHIG
HAYEAIATDVLARFARLDGKDVFFLTGTDEHGQKMVQTAAGENMAVSALAARNAGRFKEM
DERLNVSFDRFIRTTEEQHHRSSQEIWRRMEANGDIYADIYAGWYSVRDEAYYAEDETRL
TDDGVRLGPQGTPVEWVEEKSYFFRLSAYQDKLLKLYADQPDFVGPDSRKNEVVSFVKGG
LRDLSISRTTFDWGVKVPGDEEHVMYVWVDALTNYITGVGFPDESDKNWRYWPADVHIIG
KDIIRFHAVYWPAFLLSAGIPLPKRVYAHGFLFSRGEKMSKSVGNVVDPFNLADQYGVDQ
VRYFFLREVPFGQDGNYNHEAIVARINADLANDLGNLAQRSLSMIAKQLGGVLPEPGEFS
ANDKAILAMADGMVAASREAMATQQIHHWLNAVWAVVAEANRYFAGEAPWALAKTDPARQ
KTVLYVTAEVVRQIAILAQPAMPTASGLLLDSLGIPDGERNFVMLGGSKRIAPGSTLPAP
TPAFPRYIEPAA
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtggcaacgcgagctaagaaaactgctaaaggcaagggccgcaacaaggctgcgaagaaa
gccgcaaagaaggccgtgaaggcgcgcgcgtccaaggccaacgccaaggcggccaagaaa
gtcaggaagaccaagaaggccacggccaagaagggcgcgaagaagagcgccgtgaagacg
gcaaagaaggcggtcaagaaggctgcgaagaagccggctgtcgccaagaaggctgtgaag
aaagccgccaagaagccagccaacaaatcagccaagacccccgccaagtcgcctgcgaag
acggtggccaagaaggcgagggtggtcgcgcctgtgatcgcagcgccggcccccgccgcc
acgccgccgaaggctgccaagccgaaggccccgcgcgcgccgaagcccgctgcagctccg
caagccgcagcgcccgcagccgcaccaaaggctgccgcgcccgttgccgcccccgcacgc
gacaacgtcttctacatcacgaccgccatcgcctatcccaacggcagtccgcatattggc
cacgcctatgaggcgatcgcgaccgacgtgctggcgcgttttgcgcggctcgacggcaag
gacgtgttcttcctgaccggtaccgacgagcacggccagaagatggtgcagacggcggcc
ggcgagaacatggccgtctccgcgctcgctgcccgcaatgccggtcgctttaaggagatg
gacgagcgtctgaacgtgtcgttcgatcgcttcatccgcaccaccgaggagcagcatcat
cgctccagccaggagatctggcggcgcatggaagcgaacggcgatatctatgccgacatc
tatgcaggctggtattccgtgcgggacgaggcgtattacgccgaggatgagacgcgcctg
accgatgacggcgtccggctcggcccgcagggcacgccggtcgaatgggtcgaggagaag
agctatttcttccgcctgtcggcctatcaggacaagctgttgaagctttacgcggatcag
cctgacttcgttgggccggattcccgcaagaacgaggtggtgagcttcgtcaaaggcggc
ctgcgtgatctctcgatctcgcgcaccaccttcgattggggcgtcaaggtgcccggtgac
gaagagcacgtgatgtatgtctgggtcgacgcgctgaccaactacatcaccggcgtcggc
ttccccgatgagagcgacaaaaactggcgctattggccggccgatgtgcacatcatcggc
aaggacatcatccgtttccacgcggtgtattggccggcgttcctgctttcggccggcatc
ccgctgccgaagcgggtctatgcccacggcttcctgttcagcaggggcgagaagatgtcg
aagtcggtcggcaacgtcgtcgatcccttcaatcttgccgaccagtacggcgtcgaccag
gtgcgctatttcttcctgcgcgaggtgccgttcggacaggacggcaactacaaccacgag
gccatcgtggcgcgcatcaacgccgacctcgccaacgatcttggcaacctcgcgcagcgt
tcgctgtcgatgatcgccaagcaactcggcggcgtgctgcccgagcccggcgaattcagc
gccaacgacaaggcaatcctggcgatggccgacggcatggtcgccgcatcgcgcgaggcc
atggcaacgcagcagatccatcactggctcaacgccgtctgggccgtggttgcggaggcc
aaccgctatttcgcgggcgaggcgccgtgggcgctcgccaagaccgacccggccaggcag
aagacggtgctctacgtcacggccgaagtcgtgcgccagatcgcgatcctggcgcagcca
gcgatgccgaccgcttcaggattgctgctcgacagcctcggcatcccggacggggagcgc
aacttcgtcatgctcggcggttccaagcgcatcgcacccggctcgaccctgccggcgcca
acgccggcgttcccgcgctacatcgagccggcagcctag

DBGET integrated database retrieval system