KEGG   Brucella ovis: BOV_0850Help
Entry
BOV_0850          CDS       T00534                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bov  Brucella ovis
Pathway
bov00010  Glycolysis / Gluconeogenesis
bov00052  Galactose metabolism
bov01100  Metabolic pathways
bov01110  Biosynthesis of secondary metabolites
bov01120  Microbial metabolism in diverse environments
bov01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BOV_0850 (galM)
   00052 Galactose metabolism
    BOV_0850 (galM)
Enzymes [BR:bov01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BOV_0850 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABQ60772
UniProt: A0A0H3AR31
Position
I:856179..857201
Genome map
AA seq 340 aa AA seqDB search
MNSEIFGYAPDGQVVHRLTISNGPLTAKIINWGAAIQDLRMEGHPAPLVIGYRDFADYPA
HSPHLGAIAGRSANRIRNARFDLDGTVYEVEPNFLGRHNLHGGSKGLGHHVWKITATGPD
FVSLATVSPDGEMGFPGNLNVNCTYMLNADGTLIVRLEAVTDRPTICNLLHHSYFNLDDG
GEGDVLDHQFKIAGDAYLPVDEALIPDGRVLPVKDTAFDFREFRPLRMQENGRQVAYDNN
FCLAAARGPLRPCASVKAARSGIRLDISTTEPGIQLYAGNTMANDCIGLTGKPYGKHAGF
CLEPQIWPGALEYPYFPQPILRPGDIYAQTSHFTFSREED
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcggaaatcttcggctatgcgccggacgggcaggtggtccaccgcctcactatc
tccaacgggcctttgaccgcaaagatcatcaattggggcgcagctattcaggatctgcgt
atggaaggccacccggcgccactggtgatcggctatcgcgattttgccgattatccggca
cattccccgcatctgggtgcgattgcgggccgctcggccaaccgtatccgcaatgcgcgc
tttgatcttgatggaacggtttacgaggtggagccgaacttccttggccgccacaatctg
catggcggcagcaaggggctcggacaccatgtctggaagatcacggcgaccggccctgat
ttcgtgtcgcttgcaacggtttctcccgatggcgagatgggcttccccggcaatctgaat
gtgaattgcacctatatgctcaatgcggatggaacgctgattgttcggctggaggctgtg
accgacaggccaaccatatgcaatctgcttcaccacagctatttcaatctggatgacggt
ggtgagggtgatgttctcgaccaccaattcaagattgcaggcgacgcctatcttccggtg
gatgaggcgcttattccggatgggcgggttctgccggtaaaggacacggctttcgatttc
cgcgaattcaggccgcttcgtatgcaggaaaacggccgtcaggtggcgtatgacaataat
ttctgccttgcggctgcacgcggcccgctgcgcccctgcgcttcggtaaaggccgcgcgg
tccggcatccggcttgatatttcaactaccgaaccggggatacagctctatgctggcaac
accatggccaatgattgcataggactgacgggcaagccctatggcaaacatgctggcttt
tgccttgaaccacagatatggccgggcgcgctggaatatccttattttccgcagccgatc
ctgcgcccgggcgatatttacgcacagaccagccattttaccttttcacgcgaggaggat
taa

DBGET integrated database retrieval system