KEGG   Brucella ovis: BOV_0937Help
Entry
BOV_0937          CDS       T00534                                 

Definition
(GenBank) putative protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bov  Brucella ovis
Brite
Enzymes [BR:bov01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BOV_0937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_12 RrnaAD Methyltransf_32 Methyltransf_23 Methyltransf_4 Methyltransf_24 Methyltransf_9 MTS Methyltransf_18 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: ABQ61815
UniProt: A0A0H3AQ95
Position
I:942137..942805
Genome map
AA seq 222 aa AA seqDB search
MVADFQDLRTKMVDNQIRTTDVTDLAVIDAFLTVPREAFVPASRQALAHIDEDQLLESEG
PAPRYIMEPSPFAKLVQLARVSKSDVVLDIGCASGYSAAVLSQLAGSVIGLESDSSLAAA
ATARLQEFGYDNVVIVSGELRAGYPSEAPYDVIFIEGAVDFVPDVLFNQLKEGGRLVAVE
GRGNAGVARLYVKESGVASGRTVFNAAIKPLPGFECEEQFEF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtagccgatttccaggatcttcgcacaaagatggtcgataaccagatccgcacgacg
gacgtgactgatctggcggttatcgatgcgtttctgaccgttccgcgcgaggcattcgtt
ccggcaagccgtcaggctctggcccatatcgatgaagatcagcttctggaaagcgaaggc
ccggccccgcgttatatcatggagccttcgcccttcgccaagcttgtgcagcttgcccgt
gtcagcaagagcgatgtcgttctcgatatcggctgcgcatccggctattcggcggctgtc
ctttcccaattggctggatcggtcatcggtttggaaagcgattcctcgcttgcagccgcc
gcaacggcgcgtcttcaggaattcggttatgacaacgttgtgatcgtttcgggcgagttg
agggcaggctatccgtccgaagcaccctatgatgttattttcatcgaaggtgcagttgat
ttcgtcccggacgttctgttcaatcagctcaaggaaggcggtcgcctggttgcggtcgaa
ggccgtggaaatgcgggcgttgcgcgtctttacgtcaaggaaagcggcgtggcttccggg
cgtaccgttttcaatgcagcgatcaaaccgctccccggtttcgagtgtgaagagcagttc
gaattttaa

DBGET integrated database retrieval system