KEGG   Brucella ovis: BOV_1023Help
Entry
BOV_1023          CDS       T00534                                 

Definition
(GenBank) acetyl-CoA hydrolase/transferase family protein
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bov  Brucella ovis
Pathway
bov00020  Citrate cycle (TCA cycle)
bov00620  Pyruvate metabolism
bov00650  Butanoate metabolism
bov01100  Metabolic pathways
bov01110  Biosynthesis of secondary metabolites
bov01120  Microbial metabolism in diverse environments
bov01130  Biosynthesis of antibiotics
bov01200  Carbon metabolism
Module
bov_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bov_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bov00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOV_1023
   00620 Pyruvate metabolism
    BOV_1023
   00650 Butanoate metabolism
    BOV_1023
Enzymes [BR:bov01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     BOV_1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF LUD_dom CoA_trans
Motif
Other DBs
NCBI-ProteinID: ABQ61983
UniProt: A0A0H3ATZ5
Position
I:complement(1036341..1037831)
Genome map
AA seq 496 aa AA seqDB search
MLEARIRNSSLRNKVITAEQAASFIKDGMIVGMSGFTRAGDAKAVPVAMAARAATDPFQI
TLITGASLGHDVDKLLTEAHILSRRMPFQADRTLRSAINRGEVMFIDQHLSETVEQLRSN
QIGPIDCAVVEALAITESGGIIPTTSVGNSASLAILAEKVIVEVNLNQPMALEGLHDIYI
PTKRPSRDPIPIMACDSRIGLPYIPIAPEKIAGIVITQENDSASPVEPADHETVAIAGHL
IEFFKGEVVKGRLDLALNPLQAGIGTIANAVLTGFADSPFHNLRMYSEVLQDSTFDLFDA
GKLDFASGSSITLSPACGERVFNNIDRYRDRLVLRPQEISNHPEVIRRLGIIGINTALEF
DIYGNVNSTHVDGTNMMNGIGGSGDFARNAYISIFVSKSEAKNGAISSVVPMVTHVDHTE
HDVDILVTEQGLADLRGLAPRERAPVIIENCAHPDYRDQLMDYYERACKRGGHTPHLLEE
AFSWHLRRQENGSMRK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgttggaagcacgtatccgtaacagttcactgcgaaacaaggttatcactgcggagcaa
gcggcaagctttatcaaggatggcatgattgttggcatgagcggctttacgcgcgcgggc
gatgccaaggccgttccggtcgccatggccgcgcgggcggcaaccgatccattccagatc
accctgattacaggggcctccctcggacatgacgtcgataaactgttgaccgaagcgcat
attctttctcgccgtatgccgtttcaggccgaccgcacattgcgcagcgcgatcaaccgc
ggcgaagtcatgtttatcgaccagcatctttccgaaacagtcgagcaacttcgttccaac
cagatcggccccatcgactgtgccgtggtagaggcattggcgattaccgaaagcggcgga
atcatcccgacgacttcggtcggcaattcggccagcctcgccattcttgccgaaaaggtt
atcgtcgaggtcaatctgaaccagcccatggcgctggaaggcctgcacgatatttatata
ccgacgaagcgcccttcccgcgatcctatcccgatcatggcttgcgatagccggatcgga
ctgccctatattcccatcgcgccggaaaaaatcgccggtatcgtcatcacgcaggaaaat
gacagtgcgtcacctgtcgagcccgcagatcacgaaacggttgcgattgccgggcatctg
atcgaattcttcaagggggaagtcgtaaagggtcgtctggatctggcgcttaatccattg
caggcgggcatcggcaccattgccaatgcggttttgaccggctttgcagatagtcctttc
cacaatctgcgcatgtatagcgaggtattgcaggatagcacgttcgatctgttcgatgcg
ggcaagctggattttgcctccggctcatcgatcactctcagccccgcttgcggcgagcgc
gttttcaataatatagaccgctatcgtgacaggcttgtcctgcgcccgcaggaaatcagc
aaccatccggaagtcatccgccgtcttggtattatcggcatcaataccgcactcgaattc
gatatctacggcaacgtcaactcaacccatgttgatggaaccaatatgatgaacggcatt
ggcggttccggcgattttgcgcgcaacgcctatatttcgatcttcgtcagcaagtcggaa
gccaagaatggcgcgatctcctcggtcgtgcccatggtaacacatgtggaccacacggaa
catgacgtggatatcctcgtgacggaacagggacttgccgatttgcgcgggcttgcacca
cgcgagcgagcgcccgttatcattgaaaattgcgcacatcccgattaccgggaccagctc
atggattattacgagcgagcctgcaaacgcggcggccacacgcctcatcttctggaagag
gcattcagttggcacctgcgccgtcaggaaaatggcagtatgcgcaaataa

DBGET integrated database retrieval system