KEGG   Brucella ovis: BOV_1218Help
Entry
BOV_1218          CDS       T00534                                 

Definition
(GenBank) rhomboid family protein
Organism
bov  Brucella ovis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhomboid
Motif
Other DBs
NCBI-ProteinID: ABQ60589
UniProt: A0A0H3AMP1
Position
I:complement(1227858..1228619)
Genome map
AA seq 253 aa AA seqDB search
MLPKDKREQHFMSIPQPEMRGTGGREPIFNIPGVVIALIGLCVAVYVYQNYILSERQDFE
FMMNFALIPARFSMASGFVDPAVIFTFISYSFMHGSFAHIAVNMIWLAAFGSPLAGRIGA
VRMILFWVFTSVVAGLTHYALHPESLSPLVGASGAISGMMGAAARYGFRRVGYGRRSEFA
GPVLPIGLTLTLKPVLIFVGVWFLINIVTGLYSTGGADFSSIAWEAHIGGFIAGFFGIPL
MDRPRSYDAVLRR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcttccgaaagacaagagagagcagcacttcatgagcattccccagccggaaatgcgc
ggcacaggcggccgcgagccgatcttcaatattccgggtgtcgtgattgctctgatcggg
ttgtgtgtcgcggtctatgtctatcagaattatattctgagcgagcggcaggattttgag
ttcatgatgaactttgcgctgatcccggcgcgcttttcgatggcgagcggctttgttgat
ccggcggtgatttttacgtttatcagctattccttcatgcatggcagttttgcgcatatt
gccgtcaatatgatctggcttgccgcattcggctcgccgctggccgggcgaatcggcgcg
gtccggatgatcctattctgggttttcacgtcggtcgtcgcggggcttacgcattacgca
ctccatcccgaaagcctttcgccgctggtgggtgcgtcgggcgcgatttcgggcatgatg
ggagctgccgcccgctatggttttcggcgtgtcggctatggccggcgctcggaatttgcc
gggccggtgcttcccatcgggctgacgctgacgctcaagcccgtcctcatttttgtcggc
gtctggtttctcatcaatatcgtcaccggcctttattccactggcggcgccgacttttcc
agcattgcctgggaggcgcatataggcggcttcattgccgggtttttcgggattccactg
atggaccgcccgcgcagctatgatgccgttttgaggcgatag

DBGET integrated database retrieval system