KEGG   Brucella ovis: BOV_1562Help
Entry
BOV_1562          CDS       T00534                                 

Definition
(GenBank) putative 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
bov  Brucella ovis
Pathway
bov00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:bov00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    BOV_1562
Enzymes [BR:bov01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     BOV_1562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3HCDH_N AdoHcyase_NAD F420_oxidored 2-Hacid_dh_C THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: ABQ61037
UniProt: A0A0H3AQZ7
Position
I:1573086..1573880
Genome map
AA seq 264 aa AA seqDB search
MAYDAFAEFRMTGHNVIITGGAQNIGAGIAKTLSGAGAKVMIADLNGDKARQTAAAIQKE
TGNECHGMKCDVTSLSDIEQVVRETVSAFGGISTLVNNVGWGGRHEDPTAISEEDFIAAY
KLNTISAYRMSMACLPHLLKSQNATITNSGSFSSAVPAYDILAYGTAKAALNQMMVSLAH
MLAKKVRINSVLIGTVMTEGYGSAGIDEEMQEKLRHPDNLTGRAGRPEDIANTMLWLCSP
ASGWVSGQTINVHGGGGVTRLFGR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgatgcatttgccgaatttcgcatgacgggccacaatgtcatcatcaccggc
ggcgcacagaatataggcgcaggcattgcgaaaaccctgtcaggcgcaggcgcaaaggtg
atgatcgccgacctcaacggcgacaaggccaggcaaacggcggcagcaatccagaaagaa
accggcaatgaatgccatggcatgaagtgcgacgtcacttcacttagcgatatcgaacag
gtggtgcgcgaaaccgtctcggcttttggcggcatttcaaccctcgtcaacaatgtcggc
tggggcgggcgccatgaagacccgacagcgatcagcgaggaagatttcatcgcagcctat
aagctgaatacgatcagcgcctaccgcatgagcatggcttgcctgccgcatctgcttaaa
tcgcaaaacgcgacgatcaccaattccggctctttctcctctgctgtgccagcctatgac
attctggcctatggaacggcgaaagctgccctcaaccagatgatggtttcgctggctcat
atgctggcaaagaaggtgcgcatcaattccgtgctgatcggcacggtgatgacagaaggt
tacggttcagccggcatcgacgaggaaatgcaggaaaagctgcgccatcccgataacctt
accgggcgtgccggacgacccgaagatatcgccaataccatgttgtggctgtgctcgccc
gccagcggatgggtcagcggccagactatcaatgtgcatggcggcggcggcgtcacgcgc
ctcttcggcaggtga

DBGET integrated database retrieval system