KEGG   Brucella ovis: BOV_2047Help
Entry
BOV_2047          CDS       T00534                                 

Gene name
gshB
Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
bov  Brucella ovis
Pathway
bov00270  Cysteine and methionine metabolism
bov00480  Glutathione metabolism
bov01100  Metabolic pathways
Module
bov_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:bov00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BOV_2047 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BOV_2047 (gshB)
Enzymes [BR:bov01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     BOV_2047 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ABQ61888
UniProt: A0A0H3ATS7
Position
I:2059646..2060584
Genome map
AA seq 312 aa AA seqDB search
MALKVAVQMDHISTVNITGDTTFALSLEAQKRGHELFHYTPDRLSMRDGVVSARVEKMEV
RDVKGDHYTLGEPVRRDLTEMDVILLRQDPPFDMNYITTTHLLERIHPKTLVVNDPAWVR
NSPEKIFVTEFPDLMPETLITKDPQEVMDFRREFGDIILKPLYGNGGAGVFHLADGDRNL
TSLLEMFGQLFREPFIAQRYLKDVRAGDKRIILIDGEPVGALNRVPSETDARSNMHVGGR
PEQSKLTPRKREICARIGPSLKERGFILVGIDVIGDYMTEINVTSPTGIREIERFDGTNI
AALFWDAVEARR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggctctcaaagtcgcggtccagatggaccatatcagcacggtgaacatcacgggcgat
accactttcgctctctcgcttgaggcgcaaaagcgcggccacgagcttttccattatacg
cccgaccggctttccatgcgcgatggcgtggtttccgcccgcgtggaaaagatggaagtg
cgcgatgtgaagggcgatcattacacgctgggcgagcctgtccgccgcgacctcacggaa
atggatgtgatcctgctgcgccaggatccgccttttgacatgaattacatcaccacgacg
catcttctggaacgcatccatccaaagacgctggtggtcaacgatccggcctgggtacgc
aacagcccggaaaagatttttgtcaccgaatttcccgacctgatgccggaaacgctcatc
accaaggatccgcaggaggtgatggatttccgccgtgaattcggcgacatcatcctgaag
ccgctttacggcaatggcggcgcgggcgtcttccatctggcggatggcgaccgcaacctt
acctcgcttctggaaatgttcggccagcttttcagggagccgttcatcgcgcagcgctat
ctgaaagatgtgcgggcgggcgacaagcgtatcatcctcatcgatggcgagccggtgggc
gcgctgaaccgcgtgccgtccgaaaccgacgcacgctccaacatgcatgtgggcggacgc
cccgaacagagcaagttgaccccgcgtaagcgtgaaatctgcgcgcgcattggcccctcg
ctgaaagagcgcggcttcatcctcgtcggcatcgacgtgattggcgactacatgacggaa
atcaacgtgacgtcgccgacaggtatccgtgaaatcgaacgttttgacggcaccaatatt
gccgccctgttctgggatgcggtggaagccagacgataa

DBGET integrated database retrieval system