KEGG   Brucella ovis: BOV_A0059
Entry
BOV_A0059         CDS       T00534                                 

Gene name
virB5
Definition
(GenBank) P-type DNA transfer protein VirB5
  KO
K03200  type IV secretion system protein VirB5
Organism
bov  Brucella ovis
Pathway
bov03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bov00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BOV_A0059 (virB5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bov02044]
    BOV_A0059 (virB5)
Secretion system [BR:bov02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BOV_A0059 (virB5)
SSDB
Motif
Pfam: T4SS DUF4141 Adhes-Ig_like DUF6376 RPW8 Kinesin_assoc UPF0242
Other DBs
NCBI-ProteinID: ABQ62898
UniProt: A0A0H3AT13
Position
II:complement(61904..62620)
AA seq 238 aa
MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKFAQQIEQLKQQFEQQKM
QFDALTGNRGLGDILRDSTLRSYLPHNWRDLYEAVMSGGYLAAAGETANLLRKSQVYDPC
ASISDKDQRIACEAKVVKPVQDKVMTSKAYDATDKRLQEIESLMQEINKTGDPKAIAELQ
GRIESENAMIQNEDTRLHLYQQMAEAQDKLLDERQHELDAKDNARRGYPQPKALEAAY
NT seq 717 nt   +upstreamnt  +downstreamnt
atgaagaagataattctcagcttcgcattcgccctgactgtaaccagcacggcgcacgca
cagctcccggtgacagatgccggctccatcgcgcagaacctggccaaccatctcgaacag
atggtgaagttcgcccagcagatcgaacaactgaaacagcagtttgaacaacagaaaatg
cagttcgatgccctgactggcaaccgtggccttggcgatattctccgcgactctacgctg
cgtagctatctgccacataactggcgagatctctacgaagcggtgatgagcggcggctac
ctggcggcggctggcgaaacggccaacctcttacgcaaaagccaggtatacgatccgtgt
gcctccatctccgacaaagatcagcgcatcgcatgtgaggctaaagtggtgaagccggtc
caggacaaggtcatgacgtccaaagcctacgacgccactgacaaacgcctacaagagatc
gagagcttgatgcaggagatcaacaagacgggagacccgaaggcgattgccgaattgcaa
ggccggatcgaaagcgaaaatgccatgatccaaaacgaagacacccgccttcatctctac
cagcagatggcagaggcacaggacaagctcctggacgaacgccagcacgaattagacgcg
aaggataatgcccggcgcggctatccgcagccgaaagcactggaagccgcctattaa

DBGET integrated database retrieval system