KEGG   Brucella ovis: BOV_A0376Help
Entry
BOV_A0376         CDS       T00534                                 

Definition
(GenBank) putative glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bov  Brucella ovis
Pathway
bov00860  Porphyrin and chlorophyll metabolism
bov01100  Metabolic pathways
bov01110  Biosynthesis of secondary metabolites
bov01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bov00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BOV_A0376
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bov01007]
    BOV_A0376
Enzymes [BR:bov01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BOV_A0376
Amino acid related enzymes [BR:bov01007]
 Aminotransferase (transaminase)
  Class III
   BOV_A0376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABQ62623
UniProt: A0A0H3ASA3
Position
II:397182..398681
Genome map
AA seq 499 aa AA seqDB search
MPCTKTCAAACRSRSRTGCAACGSACTRYGRRPERPLSKKRLKDFVMNLFTSQFRNSQLL
ASKAHALIPGGCHTYAKGDDQYPVLAPGFIQRGSGAHVFDVDGHEYIEYGMGNRAVGLGH
AYPPVVRAVREALQDGCNFTRPSAIELDCAESFLELIEGAEMVKFCKDGSDATSGALRLA
RAYTGRDMVACCADHPFFSTDDWFIGTTKMSAGIPASVSALTATFRYNDIASVEALFEDY
PGRIAAIIMEPARADEPQDNFLHEAMRIAHENGALFILDEMITGFRWHMRGAQKLYGIVP
DLSCFGKALGNGFAISALAGKAEYMRLGGLHHTDFPRVFLLSTTHGAETHAMAAAIATMA
IYRDEPVIERLYEQGAKLAAGINEAIAGHRLQDHVRLSGRPCCLTYSTLDGNGMPSQAFR
TLFLQETIRRGVLMPSLVVSYTHSDADIARTIDAVHGALGIYVRALNDGVESCLVGRPSQ
VVYRRFNEDPASSCPPPRL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgccctgcacaaaaacctgcgcagccgcttgccgcagccggtcaagaactggctgcgcc
gcgtgcgggagcgcgtgcacacggtatggtcgacggcctgagcggccgctctcgaaaaag
cgtttgaaggattttgttatgaaccttttcacatcgcagtttcgcaattcgcaattgctg
gccagcaaggcccatgcgctcattcccggcgggtgccatacctatgccaagggagacgat
cagtatccggtgcttgcgccgggtttcatccagcgcggctcaggcgcccatgtcttcgac
gtggatggccacgaatatatcgaatatgggatgggaaaccgcgccgtcggcctcggccat
gcctatccgccggtggtgcgagccgtacgcgaggccttgcaggatggctgcaattttacc
cggccaagtgctatcgaactcgactgcgcggaaagctttctcgaactgattgagggggcg
gaaatggtcaaattctgcaaggacggctcggatgcgacttccggcgcgcttcgccttgcc
cgcgcctatacagggcgtgacatggtggcctgctgcgccgaccatcccttcttttcgacc
gacgactggttcattggcaccacgaagatgagcgcaggcattcccgcgtcggtttccgcg
ctcaccgcgacgtttcgctataatgatattgccagtgtcgaggcgcttttcgaggactat
ccggggcgcatcgccgccatcatcatggagccggcgcgcgcagacgagccgcaagacaat
tttctccatgaagccatgcgcattgcccatgaaaacggtgcacttttcattctggatgaa
atgattaccggctttcgctggcatatgcgcggcgcgcagaagctttatggtatcgtgccg
gacctttcctgtttcggaaaggcgctcggcaatggctttgccatttctgcgctcgcgggc
aaggccgaatatatgcggcttggcgggcttcaccatacggatttcccccgcgtctttctg
ctttccacgacgcatggggcggaaacccatgccatggccgcggcgattgccactatggcg
atctatcgcgatgagccggtgatcgagcgtctttatgaacaaggtgcgaagcttgccgca
ggcataaacgaggctattgccggtcatcggcttcaggatcatgtgcgcctatcggggcgg
ccttgttgcctcacctattccacgctggatggaaacggaatgccttcgcaggcatttcgc
acccttttccttcaggaaacaatccggcgcggcgtgctgatgccctcgctggttgtgagc
tacacgcatagcgatgccgatattgcccgcaccatcgatgcggttcacggtgcgctcggc
atctatgtgcgggcgctcaatgacggcgtggagtcctgtctggtcgggcggccgtcgcag
gttgtctatcgccgtttcaacgaagatccggcttcctcatgcccaccgccaagattgtaa

DBGET integrated database retrieval system