KEGG   Brucella ovis: BOV_A0392Help
Entry
BOV_A0392         CDS       T00534                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bov  Brucella ovis
Pathway
bov00071  Fatty acid degradation
bov00072  Synthesis and degradation of ketone bodies
bov00280  Valine, leucine and isoleucine degradation
bov00310  Lysine degradation
bov00362  Benzoate degradation
bov00380  Tryptophan metabolism
bov00620  Pyruvate metabolism
bov00630  Glyoxylate and dicarboxylate metabolism
bov00640  Propanoate metabolism
bov00650  Butanoate metabolism
bov00900  Terpenoid backbone biosynthesis
bov01100  Metabolic pathways
bov01110  Biosynthesis of secondary metabolites
bov01120  Microbial metabolism in diverse environments
bov01130  Biosynthesis of antibiotics
bov01200  Carbon metabolism
bov01212  Fatty acid metabolism
bov02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bov00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BOV_A0392
   00630 Glyoxylate and dicarboxylate metabolism
    BOV_A0392
   00640 Propanoate metabolism
    BOV_A0392
   00650 Butanoate metabolism
    BOV_A0392
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BOV_A0392
   00072 Synthesis and degradation of ketone bodies
    BOV_A0392
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BOV_A0392
   00310 Lysine degradation
    BOV_A0392
   00380 Tryptophan metabolism
    BOV_A0392
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BOV_A0392
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BOV_A0392
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BOV_A0392
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bov04147]
    BOV_A0392
Enzymes [BR:bov01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BOV_A0392
Exosome [BR:bov04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BOV_A0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABQ62312
UniProt: A0A0H3ARG1
Position
II:complement(413059..414249)
Genome map
AA seq 396 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVTIDEQPGKAKLDKIPTLRPAFRE
GGTVTVANSSSISDGAAALLLMRASEAEKRGLTPRAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDVDLFEINEAFAVVAMAAMRDLDLPHDKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERII
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgacttcacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggcggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttaccattgac
gagcagccgggcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggtggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcgcgcggtcatcaccggc
cacgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatgtcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccatgcgcgatctcgacctgccgcacgacaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
cttgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatctga

DBGET integrated database retrieval system