KEGG   Bordetella parapertussis 12822: BPP0123Help
Entry
BPP0123           CDS       T00140                                 

Definition
(GenBank) putative asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00250  Alanine, aspartate and glutamate metabolism
bpa01100  Metabolic pathways
bpa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BPP0123
Enzymes [BR:bpa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BPP0123
Peptidases [BR:bpa01002]
 Cysteine Peptidases
  Family C44
   BPP0123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700
Motif
Other DBs
NCBI-ProteinID: CAE39864
GeneDB: BPP0123
UniProt: Q7W268
Position
129810..131684
Genome map
AA seq 624 aa AA seqDB search
MCGVAGLIHLDGAAVDPAVLQGMTDAIAHRGPDGEGHWIDGNVGLGHRRLAIIDLSPAGH
QPMISADSRYVLSYNGEIYNFRELRAELETAGYRFKSRTDSEVLLYAVIAWGLKALKRFN
GMFAFALWDCHERRLILARDRYGIKPLYYAEQGGTLAFGSEQKAILALPGFRRKLDKAAL
LEYFTFQNIFTSKVLLEDIQILPAGHYAIVEPDRCASISLTQYWDFCFREPDVAATDQEY
REELDRLFVQAVKRQLVTDVELGSYLSGGMDSGSIAAVAAAEHPYIKTFTCGFDLNSASG
IELGFDERSKAEYMSYCFKTEHYEMVLKAGDMERILPHVACHLEEPRVGQSYPNFFAAKL
ASRFVKVVLSGAGGDELFAGYPWRYYRAVVNDDFEHYVDKYYNFWQRLLPNSELKRVFAP
IAGEVEHVWTRDIFRNVFRHHADQLYRPEDYINHSLYFEAKTFLHGLLVVEDKLSMAHGL
ETRVPFLDNDLVEFAMRCPIRLKLNNLAEVVKINENETGNKVRKFFEKNRDGKTILREVM
NHRLPADISKAEKQGFSAPDASWFKGESLEFVRRKLLDGHSPLYEIMDAATVRELVNEHL
GGIRNRRLLIWSLLSVDAWMRQTF
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcgttgccggtttgatccatctagacggtgccgcggtcgaccccgcggtactg
cagggcatgaccgatgccatcgcgcatcgcgggccggatggagaaggccattggattgac
ggcaatgtcggcctcggccaccggagactggcgatcattgacctttcgccggccggccat
cagcccatgatttcggccgattcgcgctatgtactgagctacaacggcgagatctacaac
tttcgcgagttgcgggccgagcttgaaaccgcaggatatcggttcaagtcgcgtaccgac
agcgaagtcctgctgtatgccgtcattgcctggggcttgaaagcgctgaagcgcttcaat
ggcatgttcgcgtttgcgctgtgggattgccatgagcggcggttgatactggcgcgcgat
cgctacgggatcaaaccactgtattacgccgagcagggtgggacgctggcgttcggttca
gagcaaaaagccatactggctttgccgggatttcgccgcaagctggacaaggccgcgctg
cttgaatattttacgttccagaatatctttaccagcaaggtgttgttggaggatattcag
atattgccagccggccattacgcgatcgtagagccggatcgttgcgcgtcgatttccctc
acccagtattgggatttttgtttccgggagccggacgtcgccgccacagaccaggaatat
cgcgaggagttggatcggctgtttgtccaggccgtgaagcggcagctcgtcacggatgtc
gagcttgggagctacctgagcggcggcatggattcgggctccattgccgccgtggcggcc
gctgaacatccctacataaagacctttacctgtggctttgacctgaactccgcctctggt
atcgaactgggcttcgacgagcgcagcaaagccgagtacatgtcatattgcttcaagacg
gagcattatgaaatggtcctgaaggccggcgatatggagcgtatcctgccgcatgtcgcc
tgccatctggaagagccgcgggtcggtcaaagttatcccaatttcttcgccgccaagctg
gcatccagattcgtcaaggtagtgctgtccggcgcgggcggagatgagcttttcgcaggc
tatccctggcgctactatcgcgcagtcgttaatgacgatttcgagcattacgtcgacaaa
tactacaacttttggcagcggttgctgccaaacagtgaattgaagcgtgtgttcgctccg
attgccggcgaagtcgaacatgtatggacgcgcgatatttttcgcaatgtgttccggcac
catgctgaccagctgtatcggcccgaggattacatcaatcattcgctgtatttcgaggcg
aaaaccttcctgcatggcctgctggtcgtcgaagacaagctgagcatggcgcacggcctg
gaaacgcgcgtgcccttccttgacaacgacttggtggagttcgcgatgcgatgtccgatt
cgcctgaagctgaacaatctggccgaagtcgtcaagatcaacgagaacgaaaccggcaac
aaggtaaggaagttttttgaaaagaaccgggacggcaagaccatcctgcgcgaggtcatg
aatcatcgcttgccggccgacatttccaaggcggagaagcaggggttttcggcgccggac
gccagctggttcaagggggaaagcctggagttcgtcaggcgcaaattgcttgatggccat
tcccctctgtatgaaatcatggatgcggcgacggtgcgtgaactcgtcaatgaacatctt
ggcggcatacggaatcgccgtctgctcatctggtctttgctgagcgtagatgcatggatg
cggcagacattctga

DBGET integrated database retrieval system