KEGG   Bordetella parapertussis 12822: BPP0713
Entry
BPP0713           CDS       T00140                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
bpa  Bordetella parapertussis 12822
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpa02044]
    BPP0713
Secretion system [BR:bpa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPP0713
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: CAE40122
GeneDB: BPP0713
UniProt: Q7W1H6
Position
754606..755655
AA seq 349 aa
MPRMTTNMEFADLLKTLTPSLPCGEDLEYDADFLQLQQAAVGRSEQQFGATIIPAQAPDW
RAVERLALGLLERTRDLRIIAYLTRAWTEMRGLPGYAEGVTLAAGTLEQYWDAVHPMLAS
GGEEDPMPRVNALASLGDPQGCVRGMRSACLLDDVHGRLSLRDAEALLDGGRSEADYPGG
RTRLIENLRQARLRRDDAALAVGAAAGALRRIQQQATQRLGSAWCPDYAQALRALDALLR
TWSDLDETAAAPAAAMPAEAHHAAPAPEPQPAPASWHDARIATREDAMAMLAKVSAYFET
HEPSHPAPYLIRRVQQLIPLDFHDILRNLAPQGLAQFEAWTAREAASQS
NT seq 1050 nt   +upstreamnt  +downstreamnt
ttgccgcgcatgacgacgaacatggaatttgccgacctgttgaagacgctgacgcccagc
ctgccctgcggggaggacctggagtacgacgctgatttcctgcagttgcagcaggccgcc
gtgggccgcagcgagcagcagttcggcgccaccatcatccccgcgcaggcgcccgactgg
cgcgcggtggagcggctggcgctggggctgctggagcgcacgcgcgacctgcgcatcatc
gcctacctgacgcgcgcctggaccgagatgcgcggcctgcccggctatgccgagggcgtg
acgctggccgccggcacgctggagcaatactgggacgcggtgcatccgatgctggccagc
ggcggcgaggaagacccgatgccgcgcgtcaatgcgctggcctcgctgggcgacccgcag
ggctgcgtgcgcggcatgcgctcggcctgcctgctcgacgatgtgcatggccgcctgtcg
ctgcgcgatgccgaggccctgctcgacggcggcaggagcgaggccgactatccgggcggg
cgcacgcgcctgatcgagaacctgcgccaggcgcgcctgcggcgcgacgacgcggcgctg
gccgtgggcgcggccgccggcgcgctgcgccgcatccagcagcaggccacccagcgcctg
ggctcggcctggtgtccggactatgcgcaggcgctgcgcgcgctggatgccttgctgcgc
acctggagcgacctggacgaaaccgcggcggcgcccgccgcggccatgccggccgaagcg
catcacgcggccccggcgcctgaaccccaacccgcgcccgccagctggcacgacgcgcgc
atcgccacgcgcgaagacgcgatggccatgctggccaaggtcagcgcctacttcgaaacc
catgagcccagccatccggcgccctatctgatccgccgggtgcagcagctcattcccctg
gatttccacgacatcctgcgcaacctggccccgcagggcctggcgcagttcgaggcgtgg
accgcgcgcgaggccgccagccagtcctag

DBGET integrated database retrieval system