KEGG   Bordetella parapertussis 12822: BPP0714
Entry
BPP0714           CDS       T00140                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bpa  Bordetella parapertussis 12822
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpa02044]
    BPP0714
Secretion system [BR:bpa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPP0714
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAE40123
GeneDB: BPP0714
UniProt: Q7W1H5
Position
755698..756261
AA seq 187 aa
MATTLKGSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLAGKSNTPQPEVG
ERKFLDVDIDNFDERMKSVAPRAAFQVANTLTGAGHLNVDITFESIDDFSPATVARKVGA
LNEMLEARTQLANLLTYMDGKTGAEELIGQVLQNPALLGALAAAPKPADAGPADADAESA
QPGPQAR
NT seq 564 nt   +upstreamnt  +downstreamnt
atggcaaccacgctcaaaggcagcggccagaaattcatcgccaggaatcgcgcgccgcgc
gtgcagatcgagtacgacgtggagatctacggcgccgagcgcaagatccagctgcccttc
gtcatgggcgtgctggccgacctggccggcaagtcgaacacgccgcagcccgaagtgggc
gagcgcaagttcctcgacgtcgatatcgacaatttcgacgagcgcatgaagtcggtcgcc
ccgcgggccgcgttccaggtggccaatacgctgaccggcgccggccatctgaacgtggac
atcaccttcgagagcatcgacgatttttccccggccaccgtggcgcgcaaggtgggcgcg
ctcaacgagatgctggaggcccgcacgcagctggccaacctgctgacctacatggacggc
aagaccggcgccgaggagctgatcggccaggtgctgcagaacccggccctgctgggcgcg
ctggcggccgcgcccaagcccgccgacgccgggccggccgatgccgacgccgagagcgcg
cagcccggcccgcaagcccgataa

DBGET integrated database retrieval system