KEGG   Bordetella parapertussis 12822: BPP0715Help
Entry
BPP0715           CDS       T00140                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
bpa  Bordetella parapertussis 12822
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpa02044]
    BPP0715
Secretion system [BR:bpa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPP0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB DUF1877
Motif
Other DBs
NCBI-ProteinID: CAE40124
GeneDB: BPP0715
UniProt: Q7W1H4
Position
756283..757785
Genome map
AA seq 500 aa AA seqDB search
MTAVARRERAQAESSLAADDLSALLKKEFKPKTEQAREAVEHAVRTLAHQALENSGLGLS
SDAYRTIQAIIAEIDRKLSEQINLVMHHPDFQQLEGAWRGLHYLVTNTETDELLKIRFMC
LSKNELGRTLKRYKGVGWDQSPIFKRVYEEEYGQFGGEPIGCLVGDYSFDHSPPDVELLG
EIARISAAAHCPFIAGASPNVMQMDSWQELSNPRDLTKIFTNTEYVAWRSLRELEDARYV
GLAMPRFLARLPYGARTNPVDEFDFEEETDGANHDRYTWANSAYAMAANINRSFKLYGWC
TSIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPLVHRKNSD
FAAFIGAQSLQRPQEYHDADASANAKLAARLPYLFACCRFAHYLKCIVRDKIGSFRERSD
MERWLNDWIMNYVDGDPANSSQETKARKPLAAAEVQVTEIEDNPGYYAAKFFLRPHYQLE
GLTVSLRLVSKLPSLKQNEG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagtggcccggcgcgaacgcgcgcaagccgaatccagcctggcggcggacgac
ctgtccgccctgctgaagaaagagttcaagcccaagaccgagcaggcgcgcgaggccgtg
gagcacgcggtgcgcacgctggcgcaccaggccctggaaaacagcgggctgggcctgtcc
tcggacgcctaccggaccatccaggccatcatcgccgagatcgaccgcaagctgtccgag
cagatcaacctggtgatgcaccatcccgacttccagcagctcgaaggcgcctggcgcgga
ctgcactacctggtcaccaacaccgagaccgacgagctgctgaagatccgcttcatgtgc
ctgtccaagaacgagctggggcgtacgctcaagcgctacaagggggtcggctgggaccag
agcccgatcttcaagcgcgtctacgaggaagagtacggccagttcggcggcgagcccatc
ggctgcctggtgggcgactacagcttcgaccacagtcctcccgatgtcgagctgctgggc
gagatcgcccgcatcagcgccgccgcccactgccccttcatcgccggcgcctcgcccaac
gtgatgcagatggattcctggcaggagctttccaacccgcgcgacctgaccaagatcttc
accaataccgagtacgtcgcctggcgcagcctgcgcgaattggaagacgcgcgctatgtc
ggcctggccatgccgcgcttcctggcgcgcctgccctacggcgcgcgcaccaatccggtc
gatgagttcgatttcgaggaagaaaccgacggcgccaaccacgaccggtacacctgggcc
aattcggcctacgcgatggccgccaacatcaaccgttcgttcaagctgtacggctggtgc
acctcgatccgcggcgtggaatccggcggcgcggtcgagaacctgccatgccacaccttc
ccgaccgacgacggcggagtggacatgaagtgtcccaccgagatcgccatcagcgaccgg
cgcgaggccgagctggccaagaacggcttcatgccgctggtgcatcgcaagaactccgat
ttcgccgccttcatcggcgcgcagtcgctgcagcgtccgcaggaataccacgacgccgac
gccagcgccaacgccaagctggccgcgcgcctgccctacctgttcgcctgctgccgcttc
gcgcactacctgaagtgcatcgtgcgcgacaagatcggttcgtttcgcgagcgcagcgac
atggagcgctggctcaacgactggatcatgaactacgtcgacggcgacccggccaactct
tcgcaggaaaccaaggcgcgcaagccgctggccgccgccgaggtgcaggtcaccgagatc
gaggacaacccgggctattacgccgccaagtttttcctgcggccgcactatcagctcgag
gggctgacggtgtcgctgcggctcgtgtccaagctgccttcgctcaagcagaacgaaggc
tga

DBGET integrated database retrieval system