KEGG   Bordetella parapertussis 12822: BPP0717
Entry
BPP0717           CDS       T00140                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11898  type VI secretion system protein ImpE
Organism
bpa  Bordetella parapertussis 12822
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpa02044]
    BPP0717
Secretion system [BR:bpa02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   BPP0717
SSDB
Motif
Pfam: ImpE Shal-type
Other DBs
NCBI-ProteinID: CAE40126
GeneDB: BPP0717
UniProt: Q7W1H2
Position
758378..759187
AA seq 269 aa
MQTSVLAMPPRDGGLAGQAAAVQARIRRAPADADLRAQLFQLAAVQGDWRRAAEQLQLCA
RLNPLAQPMANLYLAAIHGELRREAVLAGQAEPGFLAERPCWCEPLLQALRAQASDPERA
AMLRAQAFDAAQASAGTLEDAAAGQAGYAWICDGDSRLGPVCELILDGSYAWLPFAQVAA
VHLPAPQGLCDLVWARAEIALADGAVVRGLVPARYPPSAGQDDGLRLGRATCWRPLGQDG
YAGEGQKMWLTDAGEFALLDVRALRRQAP
NT seq 810 nt   +upstreamnt  +downstreamnt
atgcagacatccgtgcttgcgatgcccccgcgcgacggcggcctggccggtcaggccgcg
gccgtgcaggcgcgcatccggcgcgcgccggccgacgccgatttgcgcgcgcaacttttc
cagctggctgccgtgcagggcgactggcgccgcgccgccgagcaattgcaactgtgcgcc
cggctgaacccgctggcccagccgatggccaatctctacctggcggccatccatggcgag
ctgcggcgcgaagccgtgctggcgggccaggccgaacccggcttcctggccgagcggccc
tgctggtgcgagccgttgctgcaggcgctgcgcgcccaggcgagcgaccccgagcgggcc
gccatgctgcgcgcccaggcgttcgatgcggcgcaggccagcgccggcacgctggaggac
gcggccgccggccaggccggctatgcctggatctgcgacggcgacagccgcctggggccg
gtctgcgaactgattctcgacggcagctatgcgtggctgccgttcgcgcaggtggccgcc
gtgcatctgccggccccgcaagggctgtgcgatctcgtctgggcgcgcgccgaaatcgcc
ctggccgacggcgcggtcgtgcgcggcctggttccggcgcgctacccgccgtcggccggg
caggatgacggcctgaggctgggccgggccacgtgctggcggccgctgggccaggacggc
tacgccggcgagggccagaagatgtggctgaccgacgcgggcgagttcgcgctgctggac
gtgcgcgccctgcgccggcaggcgccatga

DBGET integrated database retrieval system