KEGG   Bordetella parapertussis 12822: BPP0718
Entry
BPP0718           CDS       T00140                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
bpa  Bordetella parapertussis 12822
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpa02044]
    BPP0718
Secretion system [BR:bpa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPP0718
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: CAE40127
GeneDB: BPP0718
UniProt: Q7W1H1
Position
759184..759702
AA seq 172 aa
MRIADERVARDRLQPSLLDRLVDDEPWRRSEAPEAALLTHAGLRAAVLRDLRWLLNTVNL
ASSQDLAPYRHVPASSVNFGVRAMAGRRMSEIDWVDVETSIRDAIAAFEPRILESSVEVR
CVSDTRTLEHHNVLSLEIRGMLWCVPHPREFLFRTDIDLESGHMDLRDLGGA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgagaatcgccgacgaacgggtggcgcgcgaccgcctgcagccgtcgctgctcgatcgc
ctggtcgatgacgagccatggcgccgcagcgaggcgcccgaagcggcgctgttgacgcac
gccgggctgcgcgccgcggtactgcgcgacctgcgctggctgctcaacacggtcaacctc
gcctcgtcgcaggatctggcgccgtaccggcacgtgcccgcctccagcgtcaatttcggc
gtgcgcgccatggccggacgccgcatgtcggagatcgactgggtcgatgtcgagacgtcg
atccgcgacgccatcgcggcgttcgagccgcgcatcctggaatcctcggtcgaggtgcgc
tgcgtcagcgacacccgcacgctcgagcaccacaatgtgctcagcctggaaatacgcggc
atgctgtggtgcgtgccgcacccgcgcgagttcctgttccgcaccgatatcgacctggaa
agcgggcacatggacctgcgcgacctgggaggggcgtga

DBGET integrated database retrieval system