KEGG   Bordetella parapertussis 12822: BPP0721
Entry
BPP0721           CDS       T00140                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
bpa  Bordetella parapertussis 12822
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpa02044]
    BPP0721
Secretion system [BR:bpa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPP0721
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: CAE40130
GeneDB: BPP0721
UniProt: Q7W1G8
Position
762312..763406
AA seq 364 aa
MDAAARTDRHAAPAVLPPAFWQALAAAPHGHDLFHVLRWIDARAGARAPLGRGASPRHEP
VRMRQEPSLAFAPATLAAARAPGEGAAPELSIYSFGLFGPNGPLPLPLHLTEHARERRQH
HGDHSLAAFADLFHHRLILLFYRAWADAQSTASLDRGQERFSGYVASLLHLGAPSLRRRD
SVMDHAKYHMAGHLLRQTRNPEGLCQVLRAFFGLPVGVDEFVAQWIRLEAGQRLRLGAGG
GLGGGAPLGVAVRDAQHKFRIRLGPLDWQDYLAFLPGSARARQLLHWVRLYVGVEFAWEV
RPVLRRDAVRSVRLGAAAPLGLASWLGRRPPRLGDAAELLLDYEGRERQAARRAQAFHEK
EQAA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggacgcagcggccaggacggatcgacacgcggcgccggcggtgctgccgcctgccttc
tggcaggccctggcggcggcgccgcacgggcacgacctgtttcacgtgctgcgctggatc
gacgcgcgcgccggcgcgcgcgcgccgctgggccgcggcgcctcgccgcgccacgaaccg
gtgcgcatgcggcaggagccttcgctggctttcgcgccggccaccctggccgcggcgcgc
gcgccgggcgagggcgccgcgcccgagctgtccatctacagcttcggcctgttcggtccc
aatgggccgctgccgctgccgctgcacctgaccgagcacgcccgcgaacgccgccagcat
cacggcgaccactccctggccgcgttcgccgacctgttccaccatcgcctgatcctgctg
ttctaccgcgcctgggccgatgcgcagtccaccgccagcctggaccgcggccaggagcgc
ttcagcggctacgtggccagcctgctgcacctgggcgcgccgtcgctgcgccggcgcgac
agcgtgatggaccatgccaagtaccacatggccggccatctgctgcgccagacccgcaac
ccggaaggcctgtgccaggtgctgcgcgccttcttcggcctgcccgtgggggtagacgag
ttcgtggcgcagtggataaggttggaggccggccagcggctgcggctgggggcgggcggc
gggctgggcggcggcgcgcccctgggcgtggccgtgcgcgacgcccagcacaagttcagg
atccgcctcgggccgctggactggcaggactacctggcgttcctgcccggttcggcccgc
gcgcgccagctgctgcattgggtgcgcctgtatgtgggcgtggagttcgcctgggaggtg
cggccggtgctgcgccgcgacgcggtgcgcagcgtgcgcctgggcgcggcggcgccgctg
gggctggcgtcctggctgggccggcggccgccgcgcctgggcgacgccgccgagctgttg
ctggactacgaggggcgcgagcgccaggcggcgcggcgcgcgcaagcgtttcatgaaaag
gagcaagcggcatga

DBGET integrated database retrieval system