KEGG   Bordetella parapertussis 12822: BPP0727
Entry
BPP0727           CDS       T00140                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPP0727
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpa02044]
    BPP0727
Secretion system [BR:bpa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPP0727
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: CAE40136
GeneDB: BPP0727
UniProt: Q7W1G2
Position
768487..769029
AA seq 180 aa
MLVAVPTRRALRAAAWIAVAVLAAGCASTASRKAAPYAIELKADPRINPDASGRPSPIQV
TLYELRSSAEFEARDFFTLQGDAQAALGKSLIETDQVILQPGETRKLSYPGNTEARVVGI
VAAYRDLERSPWRIVVPLPQAQNTNIYKFWQFSPNEETVRVAVGGQGVQIVDRERSWWPF
NT seq 543 nt   +upstreamnt  +downstreamnt
ttgcttgttgctgtgcccacgcggcgcgcgttgcgcgcggcggcctggattgccgtcgcg
gtgctggccgccgggtgcgcgtccacggccagccgcaaggcggcgccttacgcgatcgag
ctgaaggccgatccgcgcatcaatcccgatgcctcgggccggccctcgccgatccaggtc
acgctgtacgagctgcgttcgtccgccgagttcgaggcgcgcgatttcttcaccctgcaa
ggcgacgcgcaggccgcgctgggcaagtcgctcatcgaaaccgaccaggtcatcctgcag
cccggcgaaacccgcaagctgtcgtatccgggcaataccgaggcgcgcgtggtcggcatc
gtggcggcctatcgcgacctcgagcgcagtccctggcgcatcgtcgtgcccctgccgcag
gcccagaacaccaacatctacaagttctggcagttctcgcccaacgaggagaccgtgcgc
gtcgcggtgggcggacagggcgtgcaaatcgtcgaccgggagcgttcctggtggcccttc
tga

DBGET integrated database retrieval system