KEGG   Bordetella parapertussis 12822: BPP0730Help
Entry
BPP0730           CDS       T00140                                 

Definition
(GenBank) putative membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPP0730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpa02044]
    BPP0730
Secretion system [BR:bpa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPP0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C AAA_28
Motif
Other DBs
NCBI-ProteinID: CAE40139
GeneDB: BPP0730
UniProt: Q7W1F9
Position
771707..775312
Genome map
AA seq 1201 aa AA seqDB search
MIPRLFGWLFSRGLWSFLGLVALALLVWIAGPLLAIGALRPLESETARVLVIAALFAFAL
LRLLWRKWREGRLNAQLLGQLRRPARPEAEAAAEPPPSDLRELEGRFDEAVELLRKTRFD
GGGGRGWLQRYSRQYLYQLPWYVIIGAPGSGKTTALVNSGLDFPLAERFGKAALRGVGGT
RNCDWWFTDDAVLLDTAGRYTTHESDPTGDEESWRGFLGLLTRFRGRQPINGAMLTVSIE
DLLAASDAERARHAAVLRRRLQELREQLGIHFPVYVLVTKADLLAGFEQYFASFSREDLE
QVWGFTLPYARAQEPDFDLYEAFHAEYRLLQRRLDDALPEVLAAEPDEARRALAYLLPQQ
FAGLQAVLGHFLSDVFASSRFEERLVPRGVYFTSGTQGGETFDQVTGHLKRYLRIESGPA
PAAAEEGRSFFLKRLLQDVIFPEAGLAGRNLRWERRYRRLHWAGYGLITLAFLGLAAGWL
ASYGNNVRYLDEVARRVPTVDKLGRDIKITRSGDVLGLMPFLDGLWYLPRDAAFEPDAPP
LSYRFGLYQGGKMHAAMQGVYRGTLDSVLLPQVARRIEAALRAARADDLEYGYEALRAYL
MLYEADHYDAEFMHAWLLSDMQGTLPEGYTRRQYDLMSLHLRQLAQGGVLASPFPRDEAL
VRQARDELARHTLAQRAYSRLRRMLAGADDQPPTTAVTLGGPQASAVFVRKSGKPLAQGI
AALYTYRGYWDVFNPRVTRVAERLRSDDAWVLDIAPPGVLDEAARQQLIVDIKRLYLNDY
VARWDGYLDDLALAPRSSLLQSIQLARTLSAPDSPLVRLTQGVARETTLLRDAGGDERSL
ADQARDRVSSTREALEQMFGPTGPGAATRADAGDGKLERVVDQHFEPWRRLARADGQGGA
PIAATTSLVNELYTYLTAADAALRSASPAPASDVVTKLRAEAGRLPRPLRDVLDDLSTGA
AGEVSGVARERLGEDLYATIGLFCRQAIAGRYPFAPGSPRDVAPNDLARLFAPNGMIDEF
FQKNLVSQIDVSEARWRFKPGMDGTPGQASALLDSFQRAAAIRDAYFMAGSAEPAFRVSI
RPVEMDPAITQFVMDVDGQTVRYAHGPQVATSVQWPGPRGANQVRIELTPQAGAAGLSAS
GPWALNRLLDQARVTRGASPEISLASFDIGGRKVVLEIRAGSVRSPFHLAEMRGFSCPGR
S
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgcgcctgttcggatggctgttctcgcgcggcctgtggagcttcctgggcctg
gtggcgctggccctgctggtgtggatcgccgggccgctgctggcgatcggcgcgctgcgc
ccgctggaaagcgagaccgcgcgcgtactggtcatcgccgcgctgttcgccttcgcgctg
ctgcgcctgctgtggcgcaagtggcgcgaaggccgcctcaacgcccagttgctgggccag
ctgcgccggccggcccgtcccgaggccgaggccgcggccgagccgccgccttcggacctg
cgcgaactggaaggccgcttcgacgaggcggtggagctgttgcgcaagacgcgcttcgac
ggaggcggcggacgcggctggctgcagcgctattcgcgccaatacctgtaccagctgccc
tggtacgtcatcatcggcgcgccaggctcgggcaagaccacggccctggtcaactcgggc
ctggacttcccgctggccgagcgcttcggcaaggccgcgctgcgcggcgtgggcggcacc
cgcaactgcgattggtggttcaccgacgacgcggtgctgctcgataccgccggccgctac
accacccatgaaagcgaccccaccggcgacgaggagtcctggcgcggctttctcggcctg
ttgacgcgctttcggggccgccagcccatcaacggcgccatgctcaccgtcagcatcgag
gacttgctggccgcgtccgacgccgagcgcgcgcgccacgccgcggtgctgcgccggcgc
ctgcaggagctgcgcgagcagctgggcatccatttcccggtctatgtgctggtgaccaag
gccgacctgctggccggcttcgagcagtacttcgcctcgttcagccgcgaagacctggag
caggtatggggcttcaccttgccctatgcgcgcgcccaggagccggacttcgacctgtac
gaagcctttcatgccgagtaccggctgctgcagcgccggctcgacgatgccctgcccgaa
gtgctggccgccgagccggacgaggcgcgccgcgcgctggcctacctgctgccgcagcag
ttcgccggcctgcaggccgtgctgggccatttcctcagcgacgtgttcgccagctcgcgc
ttcgaggagcgcctggtgccgcgcggcgtgtacttcaccagcggcacccagggcggcgag
accttcgaccaggtcaccggccacctcaagcgctatctgcgcatcgaaagcgggccggcc
ccggccgccgccgaggaaggccgcagcttcttcctcaagcggctgctgcaggacgtgatc
tttcccgaggccggcctggccggccgcaacctgcgctgggagcgccgctaccgccgcctg
cactgggccggctacggcctgatcacgctggcgttcctgggcctggcggcgggctggctg
gccagctacggcaacaacgtgcgctatctcgacgaagtggcgcgccgcgtgccgacggtg
gacaagctggggcgcgatatcaagatcacccgctcgggcgatgtgctgggcctgatgccc
ttcctggacggcctgtggtacctgccgcgcgacgccgccttcgagccggacgcgccgccg
ctgtcctatcgcttcgggctgtaccagggcggcaagatgcacgccgcgatgcagggcgtt
tatcgcggcacgctcgacagcgtcctgctgccgcaggtggcgcgccgcatcgaggcggcg
ctgcgcgcggcccgcgccgacgacctggagtacggctacgaggccctgcgcgcctacctg
atgctgtacgaggccgaccactacgacgccgagttcatgcacgcctggctgctgtccgac
atgcagggcacgctgcccgagggctacacgcgccggcagtacgacctgatgtcgctgcac
ctgcgccagctggcgcagggcggcgtgctggcctcgccgtttccgcgcgacgaggcgctg
gtgcggcaggcgcgcgacgaactggcgcgccacacgctggcgcagcgcgcctacagccgg
ctgcgccgcatgctggccggcgccgacgatcagccgccgaccaccgcggtgacgctgggc
gggccgcaggccagcgccgtcttcgtgcgcaagagcggcaagccgctggcccagggcatc
gcggcgctgtacacctaccgcggctattgggacgtgttcaatccgcgcgtcacgcgcgtg
gccgagcgcctgcgcagcgacgatgcctgggtcctggacatcgcgccgccgggcgtgctg
gacgaggctgcgcgccagcagctcatcgtcgacatcaagcgcctgtacctcaacgactac
gtggcgcgctgggacggctacctggacgacctggcgctggcgccgcgcagctcgctgctg
caaagcatccagctggcgcgcaccctgtcggcgcccgattcgccgctggtgcggctgacc
cagggcgtggcgcgcgagaccacgctgctgcgcgacgcgggcggcgacgagcgctcgctg
gcggaccaggcgcgcgaccgcgtcagcagcacgcgcgaggcgctggagcagatgttcggc
ccgaccggcccgggtgcggccacgcgcgccgacgccggcgacggcaagctggagcgcgtg
gtcgaccagcacttcgagccatggcgcaggctggcgcgcgccgacgggcagggcggcgcg
ccgattgccgccaccaccagcctggtcaacgagctgtacacctatctgacggcggccgac
gcggctctgcgcagcgccagcccggcgcccgcctccgatgtggtgaccaagctgcgcgcc
gaggctggccgcctgccgcggcccttgcgcgacgtgctcgacgacttgtccaccggcgcg
gcgggcgaagtgtccggcgtggcgcgcgagcggctgggcgaagacctgtacgccaccatc
ggcctgttctgccgccaggccatcgccggccgctatcctttcgcgcccggctcgccgcgc
gacgtcgcgcccaatgacctggcgcggctgttcgcgcccaacggcatgatagacgagttc
ttccagaagaacctggtcagccagatcgatgtgtccgaggcgcgctggcgcttcaagccg
ggcatggacggcacgccgggccaggcgtcggcgctgctggattcgttccagcgcgccgcc
gcgatccgcgacgcctatttcatggccggcagcgcggagccggcctttcgcgtctcgatc
cgtccggtggaaatggacccggccatcacgcaattcgtcatggacgtggacggccagacc
gtgcgctatgcgcatggcccgcaggtcgccacctccgtgcaatggccggggccgcgcggc
gccaaccaggtgcgcatcgagctgacgccccaggccggcgcggcgggcctgtcggccagc
ggaccgtgggcactcaatcgcctgctcgaccaggcccgcgtcacgcgcggcgcctcgccc
gagatctcgctggccagcttcgatatcggcggccgcaaagtggtgctggagatccgcgcg
ggcagcgtcaggagcccctttcacctggccgagatgcggggtttttcctgcccgggccgt
tcatga

DBGET integrated database retrieval system